PRGDB00047227 (CTV.4)

From PRG Wiki
Jump to: navigation, search
CTV.4
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 160693161 (EU254147)
Gene Class Unknown
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR
Gene Species Citrus aurantiifolia

Comment?

Citrus aurantiifolia cultivar Mexican lime haplotype 2 NBS-LRR type disease resistance protein (CTV.4) gene, partial cds.

DNA Sequence

GGTTCCTACATGCCCTCATCTCCTTACTTTATTTCTTAACAATAACGAACTCTTACTGAGAATCAACNCTGANTTCTTGCAGTCTATGCCTAGTCTCAAAGTTTTAAACCTCTCACGTTACATGGGATTATTGGAATTACCTGCGGNGATTTCAAAGTTGGTTTCACTTGAACACCTTGATCTTTCCACCACACTTATACGTGAGATTCCTGAAGATTTAAAAGCGTTGGTAAATCTTAAATGTTTGAATTTGGAAAACGCATGTTTTTTATTTAAAATTCCTCTGCAACTAATATCTAATTTTTCGAGGTTACATGTGCTGAGAATGTTCGGTACTGGTTATTTTTCCTGCGGCCTTTATCCAGAAGACAGCGTTTTATTTGGTGGGGGAGAACTCTTAGTAAAGGAGTTGCTTGATTTGAAACATCTAGAGGTATTGAGGTTGACCTTGGGAAGTTCTCGTGCCCTCCAAAGTTTTTTGACCTCACATATGCTACGAAGTTGTACTCAAGCTTTGCTCCTCCAAGACTTCAAAGGTTCGACCTCGGTTGATGTTCCTGGCTTGGCAAGTCTGAAGCAGCTAAAAAGATTACGGATTTCAGACTGTTATGAATTGGTAGAATTGAAGATTGATTATGCAGGGGAAGTACAACATTTTGGTTTCCACAGCCTTCAGAGTTTTGAAGTAAGCTTTTGCTCTGAATTGAAGGACTTGACACTCCTTGTTTTGATTCCAAACCTCAAGTCCATTGCAGTAACAGATTGCAAGGCTATGGAAGAAATCATTAGTGTGGGAGAATTTGCTGGAAATCCAAA


Protein sequences

Name Description Sequence
NBS-LRR type disease resistance protein NBS-LRR type disease resistance protein [Citrus aurantiifolia].

VPTCPHLLTLFLNNNELLLRINXXFLQSMPSLKVLNLSRYMGLLELPAXISKLVSLEHLDLSTTLIREIPEDLKALVNLKCLNLENACFLFKIPLQLISNFSRLHVLRMFGTGYFSCGLYPEDSVLFGGGELLVKELLDLKHLEVLRLTLGSSRALQSFLTSHMLRSCTQALLLQDFKGSTSVDVPGLASLKQLKRLRISDCYELVELKIDYAGEVQHFGFHSLQSFEVSFCSELKDLTLLVLIPNLKSIAVTDCKAMEEIISVGEFAGNP

Domains

Domain Start-End Description Sequence

superfamily: SSF52047
3-262 SSF52047,LRR

TCPHLLTLFLNNNELLLRINXXFLQSMPSLKVLNLSRYMGLLELPAXISKLVSLEHLDLSTTLIREIPEDLKALVNLKCLNLENACFLFKIPLQLISNFSRLHVLRMFGTGYFSCGLYPEDSVLFGGGELLVKELLDLKHLEVLRLTLGSSRALQSFLTSHMLRSCTQALLLQDFKGSTSVDVPGLASLKQLKRLRISDCYELVELKIDYAGEVQHFGFHSLQSFEVSFCSELKDLTLLVLIPNLKSIAVTDCKAMEEII

HMMPanther: PTHR23155
4-263 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

CPHLLTLFLNNNELLLRINXXFLQSMPSLKVLNLSRYMGLLELPAXISKLVSLEHLDLSTTLIREIPEDLKALVNLKCLNLENACFLFKIPLQLISNFSRLHVLRMFGTGYFSCGLYPEDSVLFGGGELLVKELLDLKHLEVLRLTLGSSRALQSFLTSHMLRSCTQALLLQDFKGSTSVDVPGLASLKQLKRLRISDCYELVELKIDYAGEVQHFGFHSLQSFEVSFCSELKDLTLLVLIPNLKSIAVTDCKAMEEIIS

Gene3D: G3DSA:3.80.10.10
4-112 G3DSA:3.80.10.10

CPHLLTLFLNNNELLLRINXXFLQSMPSLKVLNLSRYMGLLELPAXISKLVSLEHLDLSTTLIREIPEDLKALVNLKCLNLENACFLFKIPLQLISNFSRLHVLRMFGT

HMMPanther: PTHR23155:SF108
4-263 PTHR23155:SF108,SUBFAMILY NOT NAMED

CPHLLTLFLNNNELLLRINXXFLQSMPSLKVLNLSRYMGLLELPAXISKLVSLEHLDLSTTLIREIPEDLKALVNLKCLNLENACFLFKIPLQLISNFSRLHVLRMFGTGYFSCGLYPEDSVLFGGGELLVKELLDLKHLEVLRLTLGSSRALQSFLTSHMLRSCTQALLLQDFKGSTSVDVPGLASLKQLKRLRISDCYELVELKIDYAGEVQHFGFHSLQSFEVSFCSELKDLTLLVLIPNLKSIAVTDCKAMEEIIS

Gene3D: G3DSA:3.80.10.10
159-256 G3DSA:3.80.10.10

FLTSHMLRSCTQALLLQDFKGSTSVDVPGLASLKQLKRLRISDCYELVELKIDYAGEVQHFGFHSLQSFEVSFCSELKDLTLLVLIPNLKSIAVTDCK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox