PRGDB00047232 (CTV.4)

From PRG Wiki
Jump to: navigation, search
CTV.4
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 160693151 (EU254142)
Gene Class Unknown
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR
Gene Species Citrus webberi

Comment?

Citrus webberi cultivar Kalpi lime haplotype 1 NBS-LRR type disease resistance protein (CTV.4) gene, partial cds.

DNA Sequence

GGTTCCTACATGCCCTCATCTCCTTACTTTATTTCTTAACAATAACGAACTCTTACTTAGAATCAACACTGACTTCTTGCAGTCTATGCCTAGTCTCAAAGTTTTAAACCTCTCACGTTACATGGGATTATTGGAATTACCTTCNGGGATTTCAAAGTTGGTTTCACTTGAACACCTTGATCTTTCCACCACACTTATACGTGAGATTCCTGAAGATTTAAAGGCGTTGGTAAATCTTAAATGTTTGAATTTGGAAAACGCATGTTTTTTATTTAAAATTCCTCTGCAACTAATATCTAATTTTTCGAGGTTACATGTGCTGAGAATGTTCGGTACTGGTTATTTTTCCTGCGGCCTTTATCCAGAAGACAGCGTTTTATTTGGTGGGGGAGAACTCTTAGTAAAGGAGTTGCTTGATTTGAAACATCTAGAGGTATTAAGGTTGACCTTGGGAAGTTCTCGTGCCCTCCAAAGTTTTTTGACCTCACATATGCTACGAAGTTGTACTCAAGCTTTGCTCCTCCAAGACTTCAAAGGTTCGACCTCGGTTGATGTTCCTGGCTTGGCAAATCTGAAGCAGCTAAAAAGATTACGGATTTCAGACTGTTATGAATTGGTAGAATTGAAGATTGATTATGCAGGGGAAGTACAACATTTTGGTTTCCACAGCCTTCAGAGTTTTGAAGTAAGCTTTTGCTCTGAATTGAAGGACTTGACACTCCTTGTTTTGATTCCAAACCTCAAGTCCATTGCAGTAACAGATTGCGAGGCTATGGAAGAAATCATTAGTGTGGGAGAATTTGCTGGAAATCCAAA


Protein sequences

Name Description Sequence
NBS-LRR type disease resistance protein NBS-LRR type disease resistance protein [Citrus webberi].

VPTCPHLLTLFLNNNELLLRINTDFLQSMPSLKVLNLSRYMGLLELPSGISKLVSLEHLDLSTTLIREIPEDLKALVNLKCLNLENACFLFKIPLQLISNFSRLHVLRMFGTGYFSCGLYPEDSVLFGGGELLVKELLDLKHLEVLRLTLGSSRALQSFLTSHMLRSCTQALLLQDFKGSTSVDVPGLANLKQLKRLRISDCYELVELKIDYAGEVQHFGFHSLQSFEVSFCSELKDLTLLVLIPNLKSIAVTDCEAMEEIISVGEFAGNP

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF108
4-263 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

CPHLLTLFLNNNELLLRINTDFLQSMPSLKVLNLSRYMGLLELPSGISKLVSLEHLDLSTTLIREIPEDLKALVNLKCLNLENACFLFKIPLQLISNFSRLHVLRMFGTGYFSCGLYPEDSVLFGGGELLVKELLDLKHLEVLRLTLGSSRALQSFLTSHMLRSCTQALLLQDFKGSTSVDVPGLANLKQLKRLRISDCYELVELKIDYAGEVQHFGFHSLQSFEVSFCSELKDLTLLVLIPNLKSIAVTDCEAMEEIIS

superfamily: SSF52058
4-262 L domain-like,LRR

CPHLLTLFLNNNELLLRINTDFLQSMPSLKVLNLSRYMGLLELPSGISKLVSLEHLDLSTTLIREIPEDLKALVNLKCLNLENACFLFKIPLQLISNFSRLHVLRMFGTGYFSCGLYPEDSVLFGGGELLVKELLDLKHLEVLRLTLGSSRALQSFLTSHMLRSCTQALLLQDFKGSTSVDVPGLANLKQLKRLRISDCYELVELKIDYAGEVQHFGFHSLQSFEVSFCSELKDLTLLVLIPNLKSIAVTDCEAMEEII

HMMPanther: PTHR23155
4-263 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

CPHLLTLFLNNNELLLRINTDFLQSMPSLKVLNLSRYMGLLELPSGISKLVSLEHLDLSTTLIREIPEDLKALVNLKCLNLENACFLFKIPLQLISNFSRLHVLRMFGTGYFSCGLYPEDSVLFGGGELLVKELLDLKHLEVLRLTLGSSRALQSFLTSHMLRSCTQALLLQDFKGSTSVDVPGLANLKQLKRLRISDCYELVELKIDYAGEVQHFGFHSLQSFEVSFCSELKDLTLLVLIPNLKSIAVTDCEAMEEIIS

HMMPfam: PF13855
5-64 LRR_8,Leucine rich repeat

PHLLTLFLNNNELLLRINTDFLQSMPSLKVLNLSRYMGLLELPSGISKLVSLEHLDLSTT

Seg: seg
7-19 seg

LLTLFLNNNELLL

Seg: seg
125-148 seg

VLFGGGELLVKELLDLKHLEVLRL

Gene3D: G3DSA:3.80.10.10
161-253 no description

TSHMLRSCTQALLLQDFKGSTSVDVPGLANLKQLKRLRISDCYELVELKIDYAGEVQHFGFHSLQSFEVSFCSELKDLTLLVLIPNLKSIAVT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox