PRGDB00047243 (F18B3.240)

From PRG Wiki
Jump to: navigation, search
F18B3.240
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 4835223 (AL049862)
Gene Class CNL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana DNA chromosome 3, BAC clone F18B3.

DNA Sequence

ATGGTGGACGCTGTTGTAACAGTGTTTTTAGAGAAAACCTTGAACATCCTCGAAGAAAAAGGCCGAACCGTATCGGACTACCGAAAACAGTTGGAAGATTTGCAAAGCGAATTGAAATATATGCAGTCTTTTCTCAAGGATGCAGAGAGGCAGAAGAGAACTAATGAAACGTTGCGTACTCTTGTTGCGGATTTACGAGAACTGGTTTACGAAGCTGAGGATATACTTGTGGATTGTCAGCTCGCGGATGGTGATGATGGGAACGAGCAAAGGTCATCAAATGCGTGGCTTTCGCGGCTTCATCCTGCCCGGGTTCCGTTGCAGTACAAGAAAAGCAAACGTTTGCAAGAGATCAATGAGAGGATAACGAAAATAAAGAGTCAAGTAGAGCCTTATTTCGAATTCATAACGCCGAGTAATGTTGGAAGAGATAATGGAACTGATCGGTGGAGCTCTCCGGTGTATGATCATACTCAGGTGGTTGGTTTGGAAGGAGATAAAAGAAAAATCAAGGAGTGGCTCTTTCGATCAAACGACAGCCAGCTTTTGATAATGGCCTTTGTTGGGATGGGAGGGCTAGGTAAAACTACAATCGCTCAAGAAGTGTTCAATGACAAAGAGATCGAACATCGTTTCGAAAGAAGGATATGGGTGTCTGTGTCCCAGACTTTTACTGAAGAACAGATCATGAGAAGCATATTGAGGAACTTGGGGGACGCGAGTGTTGGAGATGATATTGGAACATTGCTGAGAAAAATCCAGCAGTATCTTTTGGGGAAAAGGTACTTGATAGTTATGGACGATGTATGGGACAAGAATTTGAGCTGGTGGGACAAGATCTACCAAGGACTGCCTAGAGGACAAGGAGGTAGCGTTATCGTGACCACAAGGTCGGAATCTGTAGCGAAAAGGGTGCAAGCGAGAGACGACAAGACTCACCGTCCAGAGCTCCTTAGTCCTGATAACAGTTGGCTGCTGTTTTGTAATGTGGCATTTGCAGCAAATGACGGTACTTGTGAGCGTCCCGAGCTAGAGGATGTTGGCAAGGAGATTGTAACGAAATGCAAAGGTTTGCCTTTGACAATCAAAGCGGTTGGTGGGTTACTTCTGTGCAAAGACCATGTCTATCATGAATGGAGACGAATTGCAGAGCATTTTCAGGATGAGCTAAGAGGAAACACTTCTGAAACTGACAATGTTATGTCTTCTCTGCAGTTGAGCTACGATGAACTCCCTTCCCACCTTAAGTCGTGCATTCTCACGCTTTCGCTCTATCCAGAAGACTGTGTTATACCAAAACAACAACTAGTACATGGATGGATCGGAGAAGGTTTTGTCATGTGGAGAAACGGAAGATCTGCAACTGAATCTGGAGAAGACTGCTTTTCCGGGCTCACAAACAGGTGTCTAATAGAAGTTGTAGACAAAACCTATAGCGGAACCATCATCACTTGCAAGATTCATGACATGGTTCGTGATTTGGTGATCGATATAGCCAAGAAGGATTCGTTCTCTAACCCGGAAGGCCTCAACTGTCGTCACCTTGGGATTAGTGGAAACTTTGATGAGAAGCAGATCAAAGTTAACCATAAGCTGAGAGGCGTAGTGTCAACAACTAAGACAGGTGAAGTGAACAAGCTCAACTCAGACTTAGCTAAGAAATTCACAGACTGCAAATATCTTCGGGTTCTCGATATCTCGAAATCCATATTTGATGCTCCTCTGTCTGAGATTTTGGATGAGATTGCAAGCCTTCAACACTTAGCATGTCTTAGTTTGAGCAACACACATCCGTTGATCCAGTTTCCTCGTTCCATGGAAGATCTCCACAACCTTCAGATTCTAGACGCAAGCTACTGTCAGAATCTGAAACAACTTCAACCTTGCATCGTCTTGTTCAAGAAACTCCTTGTACTTGACATGACGAACTGTGGATCCCTTGAATGCTTCCCCAAGGGTATCGGAAGTCTCGTGAAGCTCGAAGTTCTGTTGGGATTTAAGCCAGCCAGGTCCAACAATGGGTGCAAGCTCAGTGAAGTGAAAAATCTCACAAACCTTCGGAAACTTGGTCTTTCTCTGACTCGTGGCGATCAGATAGAAGAGGAGGAGCTTGATTCTTTGATAAACCTAAGCAAGCTGATGTCCATTTCGATCAACTGCTATGATAGCTACGGCGATGATCTCATAACCAAAATAGACGCCCTTACTCCTCCACACCAGCTCCATGAGCTTTCTCTACAATTCTATCCTGGAAAGTCGAGTCCATCGTGGTTGAGTCCTCACAAGCTTCCGATGTTGAGGTACATGTCAATATGTTCAGGTAATTTGGTGAAAATGCAGGAACCATTCTGGGGAAACGAGAATACTCACTGGAGAATTGAAGGTTTAATGTTAAGTTCATTGTCGGACCTAGACATGGACTGGGAAGTGCTGCAACAGTCAATGCCGTACCTGAGGACCGTGACCGCAAACTGGTGTCCAGAGCTAGAGTCTTTCGCGATTGAAGATGTTGGCTTTAGAGGCGGAGTGTGGATGAAAACACCATTGCACAGAACCTGA


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MVDAVVTVFLEKTLNILEEKGRTVSDYRKQLEDLQSELKYMQSFLKDAERQKRTNETLRTLVADLRELVYEAEDILVDCQLADGDDGNEQRSSNAWLSRLHPARVPLQYKKSKRLQEINERITKIKSQVEPYFEFITPSNVGRDNGTDRWSSPVYDHTQVVGLEGDKRKIKEWLFRSNDSQLLIMAFVGMGGLGKTTIAQEVFNDKEIEHRFERRIWVSVSQTFTEEQIMRSILRNLGDASVGDDIGTLLRKIQQYLLGKRYLIVMDDVWDKNLSWWDKIYQGLPRGQGGSVIVTTRSESVAKRVQARDDKTHRPELLSPDNSWLLFCNVAFAANDGTCERPELEDVGKEIVTKCKGLPLTIKAVGGLLLCKDHVYHEWRRIAEHFQDELRGNTSETDNVMSSLQLSYDELPSHLKSCILTLSLYPEDCVIPKQQLVHGWIGEGFVMWRNGRSATESGEDCFSGLTNRCLIEVVDKTYSGTIITCKIHDMVRDLVIDIAKKDSFSNPEGLNCRHLGISGNFDEKQIKVNHKLRGVVSTTKTGEVNKLNSDLAKKFTDCKYLRVLDISKSIFDAPLSEILDEIASLQHLACLSLSNTHPLIQFPRSMEDLHNLQILDASYCQNLKQLQPCIVLFKKLLVLDMTNCGSLECFPKGIGSLVKLEVLLGFKPARSNNGCKLSEVKNLTNLRKLGLSLTRGDQIEEEELDSLINLSKLMSISINCYDSYGDDLITKIDALTPPHQLHELSLQFYPGKSSPSWLSPHKLPMLRYMSICSGNLVKMQEPFWGNENTHWRIEGLMLSSLSDLDMDWEVLQQSMPYLRTVTANWCPELESFAIEDVGFRGGVWMKTPLHRT

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF244
2-847 PTHR23155:SF244,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

VDAVVTVFLEKTLNILEEKGRTVSDYRKQLEDLQSELKYMQSFLKDAERQKRTNETLRTLVADLRELVYEAEDILVDCQLADGDDGNEQRSSNAWLSRLHPARVPLQYKKSKRLQEINERITKIKSQVEPYFEFITPSNVGRDNGTDRWSSPVYDHTQVVGLEGDKRKIKEWLFRSNDSQLLIMAFVGMGGLGKTTIAQEVFNDKEIEHRFERRIWVSVSQTFTEEQIMRSILRNLGDASVGDDIGTLLRKIQQYLLGKRYLIVMDDVWDKNLSWWDKIYQGLPRGQGGSVIVTTRSESVAKRVQARDDKTHRPELLSPDNSWLLFCNVAFAANDGTCERPELEDVGKEIVTKCKGLPLTIKAVGGLLLCKDHVYHEWRRIAEHFQDELRGNTSETDNVMSSLQLSYDELPSHLKSCILTLSLYPEDCVIPKQQLVHGWIGEGFVMWRNGRSATESGEDCFSGLTNRCLIEVVDKTYSGTIITCKIHDMVRDLVIDIAKKDSFSNPEGLNCRHLGISGNFDEKQIKVNHKLRGVVSTTKTGEVNKLNSDLAKKFTDCKYLRVLDISKSIFDAPLSEILDEIASLQHLACLSLSNTHPLIQFPRSMEDLHNLQILDASYCQNLKQLQPCIVLFKKLLVLDMTNCGSLECFPKGIGSLVKLEVLLGFKPARSNNGCKLSEVKNLTNLRKLGLSLTRGDQIEEEELDSLINLSKLMSISINCYDSYGDDLITKIDALTPPHQLHELSLQFYPGKSSPSWLSPHKLPMLRYMSICSGNLVKMQEPFWGNENTHWRIEGLMLSSLSDLDMDWEVLQQSMPYLRTVTANWCPELESFAIEDVGFRGGVWMKT

HMMPanther: PTHR23155
2-847 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VDAVVTVFLEKTLNILEEKGRTVSDYRKQLEDLQSELKYMQSFLKDAERQKRTNETLRTLVADLRELVYEAEDILVDCQLADGDDGNEQRSSNAWLSRLHPARVPLQYKKSKRLQEINERITKIKSQVEPYFEFITPSNVGRDNGTDRWSSPVYDHTQVVGLEGDKRKIKEWLFRSNDSQLLIMAFVGMGGLGKTTIAQEVFNDKEIEHRFERRIWVSVSQTFTEEQIMRSILRNLGDASVGDDIGTLLRKIQQYLLGKRYLIVMDDVWDKNLSWWDKIYQGLPRGQGGSVIVTTRSESVAKRVQARDDKTHRPELLSPDNSWLLFCNVAFAANDGTCERPELEDVGKEIVTKCKGLPLTIKAVGGLLLCKDHVYHEWRRIAEHFQDELRGNTSETDNVMSSLQLSYDELPSHLKSCILTLSLYPEDCVIPKQQLVHGWIGEGFVMWRNGRSATESGEDCFSGLTNRCLIEVVDKTYSGTIITCKIHDMVRDLVIDIAKKDSFSNPEGLNCRHLGISGNFDEKQIKVNHKLRGVVSTTKTGEVNKLNSDLAKKFTDCKYLRVLDISKSIFDAPLSEILDEIASLQHLACLSLSNTHPLIQFPRSMEDLHNLQILDASYCQNLKQLQPCIVLFKKLLVLDMTNCGSLECFPKGIGSLVKLEVLLGFKPARSNNGCKLSEVKNLTNLRKLGLSLTRGDQIEEEELDSLINLSKLMSISINCYDSYGDDLITKIDALTPPHQLHELSLQFYPGKSSPSWLSPHKLPMLRYMSICSGNLVKMQEPFWGNENTHWRIEGLMLSSLSDLDMDWEVLQQSMPYLRTVTANWCPELESFAIEDVGFRGGVWMKT

superfamily: SSF52540
149-394 SSF52540

RWSSPVYDHTQVVGLEGDKRKIKEWLFRSNDSQLLIMAFVGMGGLGKTTIAQEVFNDKEIEHRFERRIWVSVSQTFTEEQIMRSILRNLGDASVGDDIGTLLRKIQQYLLGKRYLIVMDDVWDKNLSWWDKIYQGLPRGQGGSVIVTTRSESVAKRVQARDDKTHRPELLSPDNSWLLFCNVAFAANDGTCERPELEDVGKEIVTKCKGLPLTIKAVGGLLLCKDHVYHEWRRIAEHFQDELRGNT

Gene3D: G3DSA:3.40.50.300
161-305 G3DSA:3.40.50.300

VGLEGDKRKIKEWLFRSNDSQLLIMAFVGMGGLGKTTIAQEVFNDKEIEHRFERRIWVSVSQTFTEEQIMRSILRNLGDASVGDDIGTLLRKIQQYLLGKRYLIVMDDVWDKNLSWWDKIYQGLPRGQGGSVIVTTRSESVAKRV

HMMPfam: PF00931
IPR002182
165-450 NB-ARC,NBS
NB-ARC

GDKRKIKEWLFRSNDSQLLIMAFVGMGGLGKTTIAQEVFNDKEIEHRFERRIWVSVSQTFTEEQIMRSILRNLGDASVGDDIGTLLRKIQQYLLGKRYLIVMDDVWDKNLSWWDKIYQGLPRGQGGSVIVTTRSESVAKRVQARDDKTHRPELLSPDNSWLLFCNVAFAANDGTCERPELEDVGKEIVTKCKGLPLTIKAVGGLLLCKDHVYHEWRRIAEHFQDELRGNTSETDNVMSSLQLSYDELPSHLKSCILTLSLYPEDCVIPKQQLVHGWIGEGFVMWRN

FPrintScan: PR00364
IPR000767
184-199 DISEASERSIST
Disease resistance protein

IMAFVGMGGLGKTTIA

FPrintScan: PR00364
IPR000767
256-270 DISEASERSIST
Disease resistance protein

YLLGKRYLIVMDDVW

FPrintScan: PR00364
IPR000767
355-369 DISEASERSIST
Disease resistance protein

CKGLPLTIKAVGGLL

superfamily: SSF52058
487-838 SSF52058,LRR

IHDMVRDLVIDIAKKDSFSNPEGLNCRHLGISGNFDEKQIKVNHKLRGVVSTTKTGEVNKLNSDLAKKFTDCKYLRVLDISKSIFDAPLSEILDEIASLQHLACLSLSNTHPLIQFPRSMEDLHNLQILDASYCQNLKQLQPCIVLFKKLLVLDMTNCGSLECFPKGIGSLVKLEVLLGFKPARSNNGCKLSEVKNLTNLRKLGLSLTRGDQIEEEELDSLINLSKLMSISINCYDSYGDDLITKIDALTPPHQLHELSLQFYPGKSSPSWLSPHKLPMLRYMSICSGNLVKMQEPFWGNENTHWRIEGLMLSSLSDLDMDWEVLQQSMPYLRTVTANWCPELESFAIEDVG

Gene3D: G3DSA:3.80.10.10
525-732 G3DSA:3.80.10.10

QIKVNHKLRGVVSTTKTGEVNKLNSDLAKKFTDCKYLRVLDISKSIFDAPLSEILDEIASLQHLACLSLSNTHPLIQFPRSMEDLHNLQILDASYCQNLKQLQPCIVLFKKLLVLDMTNCGSLECFPKGIGSLVKLEVLLGFKPARSNNGCKLSEVKNLTNLRKLGLSLTRGDQIEEEELDSLINLSKLMSISINCYDSYGDDLITKI

FPrintScan: PR00364
IPR000767
607-623 DISEASERSIST
Disease resistance protein

EDLHNLQILDASYCQNL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox