PRGDB00047249 (disease resistance protein R3a-like protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein R3a-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 157280368 (EF613544)
Gene Class NL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, Others
Gene Species Solanum demissum

Comment?

Solanum demissum isolate 568A14g disease resistance protein R3a-like protein gene, complete cds.

DNA Sequence

ATGGAGATTGGCTTAGCAGTTGGTGGTGCATTTCTCTCTTCAGCTTTGAATGTTCTCTTTGATAGGCTTGCTCCTCACGGTGATCTTCTCAACATGTTTCAGAAGCATACAGATGATGTTCAGCTCTTTGAGAAGCTGGGGGACATTTTGCTTGGTCTTCAAATTGTGCTAAGTGATGCAGAGAATAAGCAAGTATCAAATCAATTTGTGAGCCAGTGGTTAAATAAGCTTCAGACTGCTGTGGACGGTGCTGAAAACTTGATAGAACAAGTCAATTATGAAGCTTTGAGGCTTAAAGTGGAAGGTCAGCTTCAAAATCTTACAGAAACAAGCAACCAGCAAGTAAGTGACCTTAACCTGTGCTTGAGTGATGATTTCTTTCTTGACATAAAGAAGAAGTTGGAAGACACTATTAAAAAATTGGAGGTGTTGGAAAAGCAAATTGGTCGCCTTGGCTTAAAGGAGCATTTTGTTTCCACTAAACAAGAAACTAGAACTTCTGTGGATGTTAAATCTGATATCTTTGGTAGGCAGAGCGAAATAGAGGATTTGATTAACCGTTTATTGTCTGAAGATGCAAGTGGGAAAAAGCTGACAGTAGTTCCTATTGTTGGAATGGGCGGCCTGGGTAAGACAGCACTTGCTAAAGCGGTTTACCATGATGAGAGGGTGAAGAACCATTTTGGTTTGAAAGCTTGGTATTGTGTTTCTGAGCCATATGATGCTTTGAGAATAACGAAAGGGTTACTTCAAGAAACTGGCTCATTTGACTCGAAGGATGTCCACAACAATCTTAATCAACTTCAAGTCAAATTGAAGGAAAGCTTAAAGGGAAAGAAGTTTCTTATTGTTTTGGATGATGTCTGGAATGACAACTACAACGAGTGGGATGACTTGAGAAATCATTTTGTACAAGGAGATACAGGAAGTAAAATCATTGTGACGACACGTAAAGAGAGTGTTGCCTTGATGATGGGAAATGAGCAAATTAGCATGGACAATTTGTCTACTGAAGCCTCTTGGTCTTTATTCAAAAGACATGCATTTGAAAACATGGATCCTATGAGACATCCAGAACTTGAAGAGGTCGGAAAACAAATTGCAGCTAAGTGCAAAGGACTGCCCTTAGCTCTGAAGACGCTCGCTGGCATGTTACGCTCCAAATCAGAGGTTGAAGGGTGGAAACGTATTTTGAGAAGTGAAATATGGGAACTGCCACAGAATGACATATTACCAGCGTTGATGTTGAGCTATAATGATCTTCCCTCACATTTAAAGCGATGTTTTTCCTTTTGTGCAATATTTCCTAAAGATTATCCATTTAGGAAAGAACAAGTTATTCATCTGTGGATTGCTAATGGTCTCGTACCAAAGGACGATGGGATAATAGAAGATTTAGGCAACCAATACTTTCAGGAGTTGAGATCAAGATCATTATTTGAAAGGGTCCCAAATCCTTCTAAAGGGAACATGGAGAATTTATTCTTAATGCATGATCTTGTCAATGATTTAGCCCAAATTGCATCTTCAAAACTTTGTATCAGGTTGGAAGAGAGCAAAGGGTCTCAAATGTTGGAAAAAAGTCGGCACTTATCTTATTCAGTGGGATATGGTGGTGAGTTTGAGAAATTGACACCCCTCTACAAATTGGAGCAGCTGAGGACATTGCTCCCGATATGTATTGATGTCAATTATTGCTCTCTAAGCAAGAGGGTGCAGCATAACATACTGCCAAGACTAAGATCCTTAAGGGCATTATCATTGTCAGGTTATACAATTAAGGAGTTGCCAAATGAGTTGTTTATGAAATTAAAGCTCCTCAGATTTTTGGACCTTTCTCTGACATGTATTGAAAAGTTGCCTGATTCTGTTTGTGGATTGTATAACTTGGAGACACTTCTCCTGTCAGATTGTTATCATCTTAAGGAGCTACCGCAGCAGATAGAGAGGTTGATTAACTTGCGTCATCTTGACATAAGCAACACTCTTGTCTTGAAGATGCCACTATATCTGAGCAAGTTGAAAAGCCTCCAAGTGTTAGTGGGAGCCAAGTTTCTTCTAGGTGGTTCGAGAATGGAAGATTTGGGTGCAGCACAGAACTTGTATGGATCTGTATCAGTTGTAGAGTTGCAAAATGTGGTTGATAGAAGGGAAGCTGTGAAGGCAAAGATGAGGAAGAAGAATCACGTTGACAAGTTATCTTTGGAGTGGAGTAAAAGTAGTAGTGCCGACAATTCAAAAACTGAAAGAGACATACTTGATGAGCTACGCCCACATAAAAACATAAAAGAAGTCCAAATCATCAGATATAGAGGGACAAAATTTCCAAATTGGCTAGCTGATCCTTGGTTTCTTAAACTGGTGAAATTGTCTCTTAGCCACTGCAAGGTCTGTGATTCCTTGCCAGCACTAGGACAACTCCCTTGTTTGAAATTCCTTTCCATCAGAGAGATGCATGGAATAACAGAGGTGACGGAAGACTTCTATGGTAGTTTGTCCTCCAAAAAGCCTTTTAACTCTCTTGAGAAGCTTGAATTTGCAGAGATGCCGGAGTGGAAGCAATGGCACATACTAGGAAATGGAGAGTTCCCTACACTTGAGAACCTTTCCATTGAAAATTGCCCTGAACTCAATTTGGAGACACCCATCCAACTTTCAAGTTTAAAAAGGTTTCATGTTATTGGTTGTCCTAAGGTTGGAGTTGTTTTTGATGATCCTCAACTGTTTACATCCCAACTTGAGGGAGTGAAGCAGATTGAGGAATTATATATCGTCAATTGTAACTCTGTTACCTCCTTACCTTTTAGCATATTGCCAAGTACCTTGAAGAAAATATGGATATTTGGTTGCCAGAAATTGAAATTGGAGCAGCCAGTTGGTGAGATGTTTCTGGAGGAATTGAGAGTGGCAGAATGTGATTGTATAGATGATATATCACCTGAGTTACTCCCAAGAGCACGCCAATTGTGGGTAGAGAATTGCCACAACCTTATTAGGTTTTTGATTCCTACTGCCACTAAAAGACTCAATATTAAGAATTGTGAGAATGTTGAAAAACTATCGGTGGGATGTGGGGGGACCCAGATGACGTCACTGACTATTTGGGAATGTTGGAAGCTCAAGTGTCTGCCAGAACATATGCAGGAACTCCTTCCATCTCTTAAGGAACTGCATCTGTGGGATTGTCCAGAAATAGAGTCCTTTCCTGAAGGAGGATTGCCCTTCAATTTACAAGTCCTTTCAATCAGGAATTGCAAGAAACTAGTGAACAGCCGAAAGGAGTGGTGTTTACAGAGACTCCCTTGTCTCACAGAGTTAGAGATCAAGCATGATGGCAGTGACGAAGAGATCAAACATTGGGAGTTGCCCTGCTCTATTCAAATTCTTGAGGTATCCAATCTGAAAACATTAAGCAGCCAACATCTCAAAAGTCTCACCGCTCTTCAATATCTACGTATTGAGGGTAATTTACCTCAAATTGAGTCAATGCTGGAACAAGGCCAGCTTTCTTTCTCCTCTTCGCTTCAAAGTCTAGACATCAGCAATTTCTATGATCTCCAATCACTTTCTGAGTCAGCACTGCCCTCCTCCCTCTCTCTGCTGACCATCAGGAATTGCCCTAATCTCCAATCCCTTCCAGTTAAAGGGATACCCTCTTCCCTCTCGTTTCTATCTATTTCCAACTGTCCATTGCTCAAACCACTACTAGAATTTGACAAGGGGGTATATTGGCCAAATATTGCTCTAATTCCCATCATATGTATCGATGAGGAATGCCTGTGA


Protein sequences

Name Description Sequence
disease resistance protein R3a-like protein disease resistance protein R3a-like protein [Solanum demissum].

MEIGLAVGGAFLSSALNVLFDRLAPHGDLLNMFQKHTDDVQLFEKLGDILLGLQIVLSDAENKQVSNQFVSQWLNKLQTAVDGAENLIEQVNYEALRLKVEGQLQNLTETSNQQVSDLNLCLSDDFFLDIKKKLEDTIKKLEVLEKQIGRLGLKEHFVSTKQETRTSVDVKSDIFGRQSEIEDLINRLLSEDASGKKLTVVPIVGMGGLGKTALAKAVYHDERVKNHFGLKAWYCVSEPYDALRITKGLLQETGSFDSKDVHNNLNQLQVKLKESLKGKKFLIVLDDVWNDNYNEWDDLRNHFVQGDTGSKIIVTTRKESVALMMGNEQISMDNLSTEASWSLFKRHAFENMDPMRHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEGWKRILRSEIWELPQNDILPALMLSYNDLPSHLKRCFSFCAIFPKDYPFRKEQVIHLWIANGLVPKDDGIIEDLGNQYFQELRSRSLFERVPNPSKGNMENLFLMHDLVNDLAQIASSKLCIRLEESKGSQMLEKSRHLSYSVGYGGEFEKLTPLYKLEQLRTLLPICIDVNYCSLSKRVQHNILPRLRSLRALSLSGYTIKELPNELFMKLKLLRFLDLSLTCIEKLPDSVCGLYNLETLLLSDCYHLKELPQQIERLINLRHLDISNTLVLKMPLYLSKLKSLQVLVGAKFLLGGSRMEDLGAAQNLYGSVSVVELQNVVDRREAVKAKMRKKNHVDKLSLEWSKSSSADNSKTERDILDELRPHKNIKEVQIIRYRGTKFPNWLADPWFLKLVKLSLSHCKVCDSLPALGQLPCLKFLSIREMHGITEVTEDFYGSLSSKKPFNSLEKLEFAEMPEWKQWHILGNGEFPTLENLSIENCPELNLETPIQLSSLKRFHVIGCPKVGVVFDDPQLFTSQLEGVKQIEELYIVNCNSVTSLPFSILPSTLKKIWIFGCQKLKLEQPVGEMFLEELRVAECDCIDDISPELLPRARQLWVENCHNLIRFLIPTATKRLNIKNCENVEKLSVGCGGTQMTSLTIWECWKLKCLPEHMQELLPSLKELHLWDCPEIESFPEGGLPFNLQVLSIRNCKKLVNSRKEWCLQRLPCLTELEIKHDGSDEEIKHWELPCSIQILEVSNLKTLSSQHLKSLTALQYLRIEGNLPQIESMLEQGQLSFSSSLQSLDISNFYDLQSLSESALPSSLSLLTIRNCPNLQSLPVKGIPSSLSFLSISNCPLLKPLLEFDKGVYWPNIALIPIICIDEECL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
11-877 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FLSSALNVLFDRLAPHGDLLNMFQKHTDDVQLFEKLGDILLGLQIVLSDAENKQVSNQFVSQWLNKLQTAVDGAENLIEQVNYEALRLKVEGQLQNLTETSNQQVSDLNLCLSDDFFLDIKKKLEDTIKKLEVLEKQIGRLGLKEHFVSTKQETRTSVDVKSDIFGRQSEIEDLINRLLSEDASGKKLTVVPIVGMGGLGKTALAKAVYHDERVKNHFGLKAWYCVSEPYDALRITKGLLQETGSFDSKDVHNNLNQLQVKLKESLKGKKFLIVLDDVWNDNYNEWDDLRNHFVQGDTGSKIIVTTRKESVALMMGNEQISMDNLSTEASWSLFKRHAFENMDPMRHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEGWKRILRSEIWELPQNDILPALMLSYNDLPSHLKRCFSFCAIFPKDYPFRKEQVIHLWIANGLVPKDDGIIEDLGNQYFQELRSRSLFERVPNPSKGNMENLFLMHDLVNDLAQIASSKLCIRLEESKGSQMLEKSRHLSYSVGYGGEFEKLTPLYKLEQLRTLLPICIDVNYCSLSKRVQHNILPRLRSLRALSLSGYTIKELPNELFMKLKLLRFLDLSLTCIEKLPDSVCGLYNLETLLLSDCYHLKELPQQIERLINLRHLDISNTLVLKMPLYLSKLKSLQVLVGAKFLLGGSRMEDLGAAQNLYGSVSVVELQNVVDRREAVKAKMRKKNHVDKLSLEWSKSSSADNSKTERDILDELRPHKNIKEVQIIRYRGTKFPNWLADPWFLKLVKLSLSHCKVCDSLPALGQLPCLKFLSIREMHGITEVTEDFYGSLSSKKPFNSLEKLEFAEMPEWKQWHILGNGEFPTLENLSIENCPEL

HMMPanther: PTHR23155:SF236
11-877 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

FLSSALNVLFDRLAPHGDLLNMFQKHTDDVQLFEKLGDILLGLQIVLSDAENKQVSNQFVSQWLNKLQTAVDGAENLIEQVNYEALRLKVEGQLQNLTETSNQQVSDLNLCLSDDFFLDIKKKLEDTIKKLEVLEKQIGRLGLKEHFVSTKQETRTSVDVKSDIFGRQSEIEDLINRLLSEDASGKKLTVVPIVGMGGLGKTALAKAVYHDERVKNHFGLKAWYCVSEPYDALRITKGLLQETGSFDSKDVHNNLNQLQVKLKESLKGKKFLIVLDDVWNDNYNEWDDLRNHFVQGDTGSKIIVTTRKESVALMMGNEQISMDNLSTEASWSLFKRHAFENMDPMRHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEGWKRILRSEIWELPQNDILPALMLSYNDLPSHLKRCFSFCAIFPKDYPFRKEQVIHLWIANGLVPKDDGIIEDLGNQYFQELRSRSLFERVPNPSKGNMENLFLMHDLVNDLAQIASSKLCIRLEESKGSQMLEKSRHLSYSVGYGGEFEKLTPLYKLEQLRTLLPICIDVNYCSLSKRVQHNILPRLRSLRALSLSGYTIKELPNELFMKLKLLRFLDLSLTCIEKLPDSVCGLYNLETLLLSDCYHLKELPQQIERLINLRHLDISNTLVLKMPLYLSKLKSLQVLVGAKFLLGGSRMEDLGAAQNLYGSVSVVELQNVVDRREAVKAKMRKKNHVDKLSLEWSKSSSADNSKTERDILDELRPHKNIKEVQIIRYRGTKFPNWLADPWFLKLVKLSLSHCKVCDSLPALGQLPCLKFLSIREMHGITEVTEDFYGSLSSKKPFNSLEKLEFAEMPEWKQWHILGNGEFPTLENLSIENCPEL

superfamily: SSF52540
156-408 SSF52540

HFVSTKQETRTSVDVKSDIFGRQSEIEDLINRLLSEDASGKKLTVVPIVGMGGLGKTALAKAVYHDERVKNHFGLKAWYCVSEPYDALRITKGLLQETGSFDSKDVHNNLNQLQVKLKESLKGKKFLIVLDDVWNDNYNEWDDLRNHFVQGDTGSKIIVTTRKESVALMMGNEQISMDNLSTEASWSLFKRHAFENMDPMRHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEGWKRILRSEIWELPQN

Gene3D: G3DSA:3.40.50.300
171-316 G3DSA:3.40.50.300

KSDIFGRQSEIEDLINRLLSEDASGKKLTVVPIVGMGGLGKTALAKAVYHDERVKNHFGLKAWYCVSEPYDALRITKGLLQETGSFDSKDVHNNLNQLQVKLKESLKGKKFLIVLDDVWNDNYNEWDDLRNHFVQGDTGSKIIVTT

HMMPfam: PF00931
IPR002182
177-460 NB-ARC,NBS
NB-ARC

RQSEIEDLINRLLSEDASGKKLTVVPIVGMGGLGKTALAKAVYHDERVKNHFGLKAWYCVSEPYDALRITKGLLQETGSFDSKDVHNNLNQLQVKLKESLKGKKFLIVLDDVWNDNYNEWDDLRNHFVQGDTGSKIIVTTRKESVALMMGNEQISMDNLSTEASWSLFKRHAFENMDPMRHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEGWKRILRSEIWELPQNDILPALMLSYNDLPSHLKRCFSFCAIFPKDYPFRKEQVIHLWIANGLVPKDD

FPrintScan: PR00364
IPR000767
200-215 DISEASERSIST
Disease resistance protein

VVPIVGMGGLGKTALA

FPrintScan: PR00364
IPR000767
275-289 DISEASERSIST
Disease resistance protein

SLKGKKFLIVLDDVW

FPrintScan: PR00364
IPR000767
371-385 DISEASERSIST
Disease resistance protein

CKGLPLALKTLAGML

superfamily: SSF52058
496-995 SSF52058,LRR

LMHDLVNDLAQIASSKLCIRLEESKGSQMLEKSRHLSYSVGYGGEFEKLTPLYKLEQLRTLLPICIDVNYCSLSKRVQHNILPRLRSLRALSLSGYTIKELPNELFMKLKLLRFLDLSLTCIEKLPDSVCGLYNLETLLLSDCYHLKELPQQIERLINLRHLDISNTLVLKMPLYLSKLKSLQVLVGAKFLLGGSRMEDLGAAQNLYGSVSVVELQNVVDRREAVKAKMRKKNHVDKLSLEWSKSSSADNSKTERDILDELRPHKNIKEVQIIRYRGTKFPNWLADPWFLKLVKLSLSHCKVCDSLPALGQLPCLKFLSIREMHGITEVTEDFYGSLSSKKPFNSLEKLEFAEMPEWKQWHILGNGEFPTLENLSIENCPELNLETPIQLSSLKRFHVIGCPKVGVVFDDPQLFTSQLEGVKQIEELYIVNCNSVTSLPFSILPSTLKKIWIFGCQKLKLEQPVGEMFLEELRVAECDCIDDISPELLPRARQLWVENCH

Gene3D: G3DSA:3.80.10.10
561-701 G3DSA:3.80.10.10

IDVNYCSLSKRVQHNILPRLRSLRALSLSGYTIKELPNELFMKLKLLRFLDLSLTCIEKLPDSVCGLYNLETLLLSDCYHLKELPQQIERLINLRHLDISNTLVLKMPLYLSKLKSLQVLVGAKFLLGGSRMEDLGAAQNL

FPrintScan: PR00364
IPR000767
649-665 DISEASERSIST
Disease resistance protein

ERLINLRHLDISNTLVL

Gene3D: G3DSA:3.80.10.10
762-897 G3DSA:3.80.10.10

IKEVQIIRYRGTKFPNWLADPWFLKLVKLSLSHCKVCDSLPALGQLPCLKFLSIREMHGITEVTEDFYGSLSSKKPFNSLEKLEFAEMPEWKQWHILGNGEFPTLENLSIENCPELNLETPIQLSSLKRFHVIGCP

Gene3D: G3DSA:3.80.10.10
910-1231 G3DSA:3.80.10.10

TSQLEGVKQIEELYIVNCNSVTSLPFSILPSTLKKIWIFGCQKLKLEQPVGEMFLEELRVAECDCIDDISPELLPRARQLWVENCHNLIRFLIPTATKRLNIKNCENVEKLSVGCGGTQMTSLTIWECWKLKCLPEHMQELLPSLKELHLWDCPEIESFPEGGLPFNLQVLSIRNCKKLVNSRKEWCLQRLPCLTELEIKHDGSDEEIKHWELPCSIQILEVSNLKTLSSQHLKSLTALQYLRIEGNLPQIESMLEQGQLSFSSSLQSLDISNFYDLQSLSESALPSSLSLLTIRNCPNLQSLPVKGIPSSLSFLSISNCPL

superfamily: SSF52058
1007-1249 SSF52058,LRR

KRLNIKNCENVEKLSVGCGGTQMTSLTIWECWKLKCLPEHMQELLPSLKELHLWDCPEIESFPEGGLPFNLQVLSIRNCKKLVNSRKEWCLQRLPCLTELEIKHDGSDEEIKHWELPCSIQILEVSNLKTLSSQHLKSLTALQYLRIEGNLPQIESMLEQGQLSFSSSLQSLDISNFYDLQSLSESALPSSLSLLTIRNCPNLQSLPVKGIPSSLSFLSISNCPLLKPLLEFDKGVYWPNIAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox