PRGDB00047251 (disease resistance protein R3a-like protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein R3a-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 157280362 (EF613540)
Gene Class NL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, Others
Gene Species Solanum demissum

Comment?

Solanum demissum isolate 568A14a disease resistance protein R3a-like protein gene, partial cds.

DNA Sequence

ATGGAGGTTGGCTTAGCAGTTGGTGGTGCATTTCTCTCTTCAGCTTTGAATGTTCTCATTGATAGGCTAGCTCCTCAGGGTGAGCTGCTCAAAATGTTTCGGAAGCGTAAGAATGATGTTCAGCTCTTAAAGAAGCTGAAATTGACTTTGTGTGGTCTTCAAGCTGTGCTAAGTGATGCAGAGAATAAGCAGGCATCAAATCAATCTGTGAGCCAGTGGCTTAATGAGCTTCGAGATGCTGTGGACTCTGCTGAAAACTTGATTGAACAAGTCAATTATGAAGCTTTGAGGCTTAAGGTGGAAGGTAAGCATCAAAATCTTGCAGAAACACTATTGAAACATTGGAGAATTTGCTACCGGTGCTTGGGTGATGATTTTTTTCCTAACATAAAGGAGAAGTTGGAAGAGACTATTGAAACATTGAAGATTTTGCAAAAGCAAATTGGTGACCTAGGCTTAACGGAACATTTTGTTTTGACCAAACAAGAAACTAGAACACCTTCAACTTCTGTGGTTGATGAATCTGATATCTTTGGTAGGCAGAAAGAAAAAAAGGTTTTGATTGACCGTCTATTGTCTGAAGATGCAAGTGGAAAAAAGCTGACTGTAGTTCCTATTGTTGGAATGGGCGGCGTGGGTAAGACAACACTTGCTAAAGCGGTTTACAATGATATGAGAGTGCAGAAACATTTTGGTTTGAAAGCTTGGTTTTGTGTTTCTGAGGCATATGATGCTTTCAGAATAACAAAAGGGTTACTTCAGGAAATTAGCTCATTTGACTTGAAGGTTGATGACAATCTTAATCAGCTACAAGTCAAATTGAAGAAAAGCTTAAAGGGAAAAACGTTTCTTATTGTTTTGGATGATGTGTGGAATGACAACTACAACGAGTGGGATGACTTGAGAAATCTTTTTGTACAAGGAGATATGGGAAATAAGATTATTGTGACTACACGTAAGGAGAGTGTTGCTTTGATGATGGGAAAGGAGCAAATTAGCATGGACAATTTGTCTATTGAAGTCTCTTGGTCTTTATTTAAAAGGCATGCATTTGAACATATGGATCCTATGGGACATCCAGAACTTGAAGAGGTTGGAAAACTAATTGCAGCTAAGTGCAAAGGACTGCCCTTAGCTCTGAAGACGCTTGCTGGCATGTTACGCTCCAAATCAGAGGTTGAAGAGTGGAAACATATTTTGAGAAGTGAAATATGGGAGCTGCCACACAATGACATATTACCAGCATTGATGTTGAGCTACAATGATCTTCCTGCACATTTAAAGCGGTGTTTTTCCTATTGTGCAATATTTCCTAAAGATTATCCATTCAAGAAAGAACAAGTTATTCATCTGTGGATTACCAATGGTCTTATACTGCAGGATGATAAAATTATTCAAGATTCAGGAAACCAATACTTTCTCGAGTTGAGATCAAGATCATTATTCGAAAGGGTCCAAAATCCTTCTGAAGGGAACATAGAGAAATTCTTAATGCATGACCTTGTCAATGATTTAGCCCAAGTTGCATCTTCAAAACTTTGTATTAGGTTGGAAGAGAGTCAAGGATCGCATATGTTGGAAAAAAGTCGGCACTTATCTTATTCAATGGGATATGGTGACTTTGAGAAGTTGACACCCCTCTACAAATTGGAGCAGCTGAGGACATTTCTTCCAATCAGTTTCCATGATGGTGCTCCACTTAGCAAGAGGGTGCAGCATAACATACTGCCAAGACTAAGATCCTTGAGGGTACTATCATTGTCTCATTACTGGATTAAGAAGTTGCCAAATGACTTGTTTATCAAATTAAAGCTCCTCAGATTTTTGGACCTTTCTCAGACATGGATTAGAAAGTTGCCTGATTCCATTTGTGTATTGTATAACTTAGAGGTACTTCTCCTGTCATCTTGTGCTTATCTTGAGGAGCTACCACTGCAGATGGAGAAGTTGATTAACTTGCGTCATCTTGACATAAGCAACAGTTTCTGCTTGAAGATGCTGCTACATCTAAGCAAGTTGAAAAGCCTCCAAGTGCTAGTGGGAGCCAAGTTTCTTTTAGGTGGTCACGGTGGTTCGAGAATGGATGATTTGGGTGAAGCACAGAACTTGTATGGATCTCTATCGATTCTAGAGTTGCAAAACGTGGTTGATAGAAGGGAAGCTGCGAAAGCAAAGATGAGGGAGAAGAATCATGTTGAGAAGTTATCTCTGGAGTGGAGTGAAAGTAGTGCCGACAATTCACAAACTGAAAGAGACATACTTGACGATCTACACCCACATACAAACATAAAGGAACTCCGAATCACCGGATATAGAGGGAAGAAATTTCCAAATTGGCTAGCTGATCCTTTGTTTCTTAAGCTAGTTAAATTGTCTCTTAGAAACTGCAAGGACTGTGATTCCTTGCCAGCACTAGGACAGCTTCCTTCTTTGAAAATCCTTTCCATTAGAGGGATGCACCGAATAACAAAGGTGACAGAAGAATTCTATGGTAGTTCGTCATCCAAAAAGTCTTTTAACTCTCTTGAGGAGCTTGAATTTGCATATATGTCGAAGTGGAAGCAATGGCACGTACTAGGTAATGGAGAGTTCCCTACACTTAAGAACCTTTCAATTAAAAATTGCCCTGAACTCAGTGTGGAGATACCCATCCAACTTGAGGGAATGAAGCAGATTGAGCGATTATCTATTGTTGATTGTAACTCTCTTACCTCTTTTCCTTTTAGCATTCTGCTGAGTACCTTGAATACAATATACATATCTGGTTGCCAGAAATTGAAATTGAAGGCGCCAGTTGGTTATTGTAACATGCTTCTAGAGGATTTGAGAGTGGAAGAATGTGAATGTATAGATGATGTATCACCTGAGTTGCTCCCAAGAGCATGCAAATTGAGTGTAGAGAGTTGCCACAACCTTACTAGGTTTTTGATTCCTACTGCCACTGAAAGTCTCTTTATTTGGAATTGTATGAATGTTGAAAAACTTTCGGTGGCATGTGGGGGGACCCAAATGACGTCACTGAGTATTGCCCAGTGTTGGAAGCTGAAGTGTCTGCCAGAGCGTATGCAGGAACTCCTTCCATCTCTTAAGGAAATGTATCTGTTTAATTGTCCAGAAGTAGAGTTTTTTCCTGAAGGAGGATTGCCCTCCAATTTGCAAGTCCTTCAGATTGTCAATTGCAAGAAACTAGTGATCGGAAGAAAGGAGTGGCATTTACAGAGACTTCCCTGTCTCATAGAGTTAGTGATCGAAGAGATTCTTGCTTGTGAGAATTGGGAGTTGCCTTCCTCTATTCAAAGACTAACCATAGACAGTCTGAAAACATTAAGCAGCCAACATCTCAAAAGCCTCACCTCTCTTCAATATCTACGTATTGCTAATTTACCTCAAATTCAGTCACTGCTGGAACCAGGGCGGCTTCCGTCATCTCTTTCTGAGCTACATTTATATAGACATCATGAGCTCCATTCACTTGGTCTTTGCCACCTCACTTCGCTTCAAAGCCTACACATCGGGAATTGCCACAATCTCCAATCACTTTCTGAATCAGCACTGCCCTCCTCTCTCTCTAAGCTAACCATCTATGATTGCCCTAATCTCCAATCACTTTCCAAATCAGTACTTCCCTCCTCCCTCTCTGAGCTGGACATCTCCCATTGCCCTAATCTCCAATCTCTTCTAGTAAAAGGGATGCCCTCTTCCCTCTCTAAACTATCTATTTCTAACTGTCCATTGCTCACACCACTACTAGAATTTGACAAGGGGGAATACTGGCCAAATATTGCTCAAATTCCCATCATTGATATCGAT


Protein sequences

Name Description Sequence
disease resistance protein R3a-like protein disease resistance protein R3a-like protein [Solanum demissum].

MEVGLAVGGAFLSSALNVLIDRLAPQGELLKMFRKRKNDVQLLKKLKLTLCGLQAVLSDAENKQASNQSVSQWLNELRDAVDSAENLIEQVNYEALRLKVEGKHQNLAETLLKHWRICYRCLGDDFFPNIKEKLEETIETLKILQKQIGDLGLTEHFVLTKQETRTPSTSVVDESDIFGRQKEKKVLIDRLLSEDASGKKLTVVPIVGMGGVGKTTLAKAVYNDMRVQKHFGLKAWFCVSEAYDAFRITKGLLQEISSFDLKVDDNLNQLQVKLKKSLKGKTFLIVLDDVWNDNYNEWDDLRNLFVQGDMGNKIIVTTRKESVALMMGKEQISMDNLSIEVSWSLFKRHAFEHMDPMGHPELEEVGKLIAAKCKGLPLALKTLAGMLRSKSEVEEWKHILRSEIWELPHNDILPALMLSYNDLPAHLKRCFSYCAIFPKDYPFKKEQVIHLWITNGLILQDDKIIQDSGNQYFLELRSRSLFERVQNPSEGNIEKFLMHDLVNDLAQVASSKLCIRLEESQGSHMLEKSRHLSYSMGYGDFEKLTPLYKLEQLRTFLPISFHDGAPLSKRVQHNILPRLRSLRVLSLSHYWIKKLPNDLFIKLKLLRFLDLSQTWIRKLPDSICVLYNLEVLLLSSCAYLEELPLQMEKLINLRHLDISNSFCLKMLLHLSKLKSLQVLVGAKFLLGGHGGSRMDDLGEAQNLYGSLSILELQNVVDRREAAKAKMREKNHVEKLSLEWSESSADNSQTERDILDDLHPHTNIKELRITGYRGKKFPNWLADPLFLKLVKLSLRNCKDCDSLPALGQLPSLKILSIRGMHRITKVTEEFYGSSSSKKSFNSLEELEFAYMSKWKQWHVLGNGEFPTLKNLSIKNCPELSVEIPIQLEGMKQIERLSIVDCNSLTSFPFSILLSTLNTIYISGCQKLKLKAPVGYCNMLLEDLRVEECECIDDVSPELLPRACKLSVESCHNLTRFLIPTATESLFIWNCMNVEKLSVACGGTQMTSLSIAQCWKLKCLPERMQELLPSLKEMYLFNCPEVEFFPEGGLPSNLQVLQIVNCKKLVIGRKEWHLQRLPCLIELVIEEILACENWELPSSIQRLTIDSLKTLSSQHLKSLTSLQYLRIANLPQIQSLLEPGRLPSSLSELHLYRHHELHSLGLCHLTSLQSLHIGNCHNLQSLSESALPSSLSKLTIYDCPNLQSLSKSVLPSSLSELDISHCPNLQSLLVKGMPSSLSKLSISNCPLLTPLLEFDKGEYWPNIAQIPIIDID

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
11-1249 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FLSSALNVLIDRLAPQGELLKMFRKRKNDVQLLKKLKLTLCGLQAVLSDAENKQASNQSVSQWLNELRDAVDSAENLIEQVNYEALRLKVEGKHQNLAETLLKHWRICYRCLGDDFFPNIKEKLEETIETLKILQKQIGDLGLTEHFVLTKQETRTPSTSVVDESDIFGRQKEKKVLIDRLLSEDASGKKLTVVPIVGMGGVGKTTLAKAVYNDMRVQKHFGLKAWFCVSEAYDAFRITKGLLQEISSFDLKVDDNLNQLQVKLKKSLKGKTFLIVLDDVWNDNYNEWDDLRNLFVQGDMGNKIIVTTRKESVALMMGKEQISMDNLSIEVSWSLFKRHAFEHMDPMGHPELEEVGKLIAAKCKGLPLALKTLAGMLRSKSEVEEWKHILRSEIWELPHNDILPALMLSYNDLPAHLKRCFSYCAIFPKDYPFKKEQVIHLWITNGLILQDDKIIQDSGNQYFLELRSRSLFERVQNPSEGNIEKFLMHDLVNDLAQVASSKLCIRLEESQGSHMLEKSRHLSYSMGYGDFEKLTPLYKLEQLRTFLPISFHDGAPLSKRVQHNILPRLRSLRVLSLSHYWIKKLPNDLFIKLKLLRFLDLSQTWIRKLPDSICVLYNLEVLLLSSCAYLEELPLQMEKLINLRHLDISNSFCLKMLLHLSKLKSLQVLVGAKFLLGGHGGSRMDDLGEAQNLYGSLSILELQNVVDRREAAKAKMREKNHVEKLSLEWSESSADNSQTERDILDDLHPHTNIKELRITGYRGKKFPNWLADPLFLKLVKLSLRNCKDCDSLPALGQLPSLKILSIRGMHRITKVTEEFYGSSSSKKSFNSLEELEFAYMSKWKQWHVLGNGEFPTLKNLSIKNCPELSVEIPIQLEGMKQIERLSIVDCNSLTSFPFSILLSTLNTIYISGCQKLKLKAPVGYCNMLLEDLRVEECECIDDVSPELLPRACKLSVESCHNLTRFLIPTATESLFIWNCMNVEKLSVACGGTQMTSLSIAQCWKLKCLPERMQELLPSLKEMYLFNCPEVEFFPEGGLPSNLQVLQIVNCKKLVIGRKEWHLQRLPCLIELVIEEILACENWELPSSIQRLTIDSLKTLSSQHLKSLTSLQYLRIANLPQIQSLLEPGRLPSSLSELHLYRHHELHSLGLCHLTSLQSLHIGNCHNLQSLSESALPSSLSKLTIYDCPNLQSLSKSVLPSSLSELDISHCPNLQSLLVKGMPSSLSKLSISNCPLLTPL

HMMPanther: PTHR23155:SF236
11-1249 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

FLSSALNVLIDRLAPQGELLKMFRKRKNDVQLLKKLKLTLCGLQAVLSDAENKQASNQSVSQWLNELRDAVDSAENLIEQVNYEALRLKVEGKHQNLAETLLKHWRICYRCLGDDFFPNIKEKLEETIETLKILQKQIGDLGLTEHFVLTKQETRTPSTSVVDESDIFGRQKEKKVLIDRLLSEDASGKKLTVVPIVGMGGVGKTTLAKAVYNDMRVQKHFGLKAWFCVSEAYDAFRITKGLLQEISSFDLKVDDNLNQLQVKLKKSLKGKTFLIVLDDVWNDNYNEWDDLRNLFVQGDMGNKIIVTTRKESVALMMGKEQISMDNLSIEVSWSLFKRHAFEHMDPMGHPELEEVGKLIAAKCKGLPLALKTLAGMLRSKSEVEEWKHILRSEIWELPHNDILPALMLSYNDLPAHLKRCFSYCAIFPKDYPFKKEQVIHLWITNGLILQDDKIIQDSGNQYFLELRSRSLFERVQNPSEGNIEKFLMHDLVNDLAQVASSKLCIRLEESQGSHMLEKSRHLSYSMGYGDFEKLTPLYKLEQLRTFLPISFHDGAPLSKRVQHNILPRLRSLRVLSLSHYWIKKLPNDLFIKLKLLRFLDLSQTWIRKLPDSICVLYNLEVLLLSSCAYLEELPLQMEKLINLRHLDISNSFCLKMLLHLSKLKSLQVLVGAKFLLGGHGGSRMDDLGEAQNLYGSLSILELQNVVDRREAAKAKMREKNHVEKLSLEWSESSADNSQTERDILDDLHPHTNIKELRITGYRGKKFPNWLADPLFLKLVKLSLRNCKDCDSLPALGQLPSLKILSIRGMHRITKVTEEFYGSSSSKKSFNSLEELEFAYMSKWKQWHVLGNGEFPTLKNLSIKNCPELSVEIPIQLEGMKQIERLSIVDCNSLTSFPFSILLSTLNTIYISGCQKLKLKAPVGYCNMLLEDLRVEECECIDDVSPELLPRACKLSVESCHNLTRFLIPTATESLFIWNCMNVEKLSVACGGTQMTSLSIAQCWKLKCLPERMQELLPSLKEMYLFNCPEVEFFPEGGLPSNLQVLQIVNCKKLVIGRKEWHLQRLPCLIELVIEEILACENWELPSSIQRLTIDSLKTLSSQHLKSLTSLQYLRIANLPQIQSLLEPGRLPSSLSELHLYRHHELHSLGLCHLTSLQSLHIGNCHNLQSLSESALPSSLSKLTIYDCPNLQSLSKSVLPSSLSELDISHCPNLQSLLVKGMPSSLSKLSISNCPLLTPL

superfamily: SSF52540
160-410 SSF52540

TKQETRTPSTSVVDESDIFGRQKEKKVLIDRLLSEDASGKKLTVVPIVGMGGVGKTTLAKAVYNDMRVQKHFGLKAWFCVSEAYDAFRITKGLLQEISSFDLKVDDNLNQLQVKLKKSLKGKTFLIVLDDVWNDNYNEWDDLRNLFVQGDMGNKIIVTTRKESVALMMGKEQISMDNLSIEVSWSLFKRHAFEHMDPMGHPELEEVGKLIAAKCKGLPLALKTLAGMLRSKSEVEEWKHILRSEIWELPHN

Gene3D: G3DSA:3.40.50.300
175-217 G3DSA:3.40.50.300

SDIFGRQKEKKVLIDRLLSEDASGKKLTVVPIVGMGGVGKTTL

HMMPfam: PF00931
IPR002182
181-462 NB-ARC,NBS
NB-ARC

QKEKKVLIDRLLSEDASGKKLTVVPIVGMGGVGKTTLAKAVYNDMRVQKHFGLKAWFCVSEAYDAFRITKGLLQEISSFDLKVDDNLNQLQVKLKKSLKGKTFLIVLDDVWNDNYNEWDDLRNLFVQGDMGNKIIVTTRKESVALMMGKEQISMDNLSIEVSWSLFKRHAFEHMDPMGHPELEEVGKLIAAKCKGLPLALKTLAGMLRSKSEVEEWKHILRSEIWELPHNDILPALMLSYNDLPAHLKRCFSYCAIFPKDYPFKKEQVIHLWITNGLILQDD

FPrintScan: PR00364
IPR000767
203-218 DISEASERSIST
Disease resistance protein

VVPIVGMGGVGKTTLA

Gene3D: G3DSA:3.40.50.300
218-318 G3DSA:3.40.50.300

AKAVYNDMRVQKHFGLKAWFCVSEAYDAFRITKGLLQEISSFDLKVDDNLNQLQVKLKKSLKGKTFLIVLDDVWNDNYNEWDDLRNLFVQGDMGNKIIVTT

FPrintScan: PR00364
IPR000767
277-291 DISEASERSIST
Disease resistance protein

SLKGKTFLIVLDDVW

FPrintScan: PR00364
IPR000767
373-387 DISEASERSIST
Disease resistance protein

CKGLPLALKTLAGML

superfamily: SSF52058
497-970 SSF52058,LRR

LMHDLVNDLAQVASSKLCIRLEESQGSHMLEKSRHLSYSMGYGDFEKLTPLYKLEQLRTFLPISFHDGAPLSKRVQHNILPRLRSLRVLSLSHYWIKKLPNDLFIKLKLLRFLDLSQTWIRKLPDSICVLYNLEVLLLSSCAYLEELPLQMEKLINLRHLDISNSFCLKMLLHLSKLKSLQVLVGAKFLLGGHGGSRMDDLGEAQNLYGSLSILELQNVVDRREAAKAKMREKNHVEKLSLEWSESSADNSQTERDILDDLHPHTNIKELRITGYRGKKFPNWLADPLFLKLVKLSLRNCKDCDSLPALGQLPSLKILSIRGMHRITKVTEEFYGSSSSKKSFNSLEELEFAYMSKWKQWHVLGNGEFPTLKNLSIKNCPELSVEIPIQLEGMKQIERLSIVDCNSLTSFPFSILLSTLNTIYISGCQKLKLKAPVGYCNMLLEDLRVEECECIDDVSPELLPRACKLSVESCH

Gene3D: G3DSA:3.80.10.10
575-679 G3DSA:3.80.10.10

ILPRLRSLRVLSLSHYWIKKLPNDLFIKLKLLRFLDLSQTWIRKLPDSICVLYNLEVLLLSSCAYLEELPLQMEKLINLRHLDISNSFCLKMLLHLSKLKSLQVL

FPrintScan: PR00364
IPR000767
648-664 DISEASERSIST
Disease resistance protein

EKLINLRHLDISNSFCL

Gene3D: G3DSA:3.80.10.10
707-715 G3DSA:3.80.10.10

LSILELQNV

Gene3D: G3DSA:3.80.10.10
757-959 G3DSA:3.80.10.10

LHPHTNIKELRITGYRGKKFPNWLADPLFLKLVKLSLRNCKDCDSLPALGQLPSLKILSIRGMHRITKVTEEFYGSSSSKKSFNSLEELEFAYMSKWKQWHVLGNGEFPTLKNLSIKNCPELSVEIPIQLEGMKQIERLSIVDCNSLTSFPFSILLSTLNTIYISGCQKLKLKAPVGYCNMLLEDLRVEECECIDDVSPELLP

superfamily: SSF52058
982-1263 SSF52058,LRR

ESLFIWNCMNVEKLSVACGGTQMTSLSIAQCWKLKCLPERMQELLPSLKEMYLFNCPEVEFFPEGGLPSNLQVLQIVNCKKLVIGRKEWHLQRLPCLIELVIEEILACENWELPSSIQRLTIDSLKTLSSQHLKSLTSLQYLRIANLPQIQSLLEPGRLPSSLSELHLYRHHELHSLGLCHLTSLQSLHIGNCHNLQSLSESALPSSLSKLTIYDCPNLQSLSKSVLPSSLSELDISHCPNLQSLLVKGMPSSLSKLSISNCPLLTPLLEFDKGEYWPNIAQ

Gene3D: G3DSA:3.80.10.10
1024-1081 G3DSA:3.80.10.10

ELLPSLKEMYLFNCPEVEFFPEGGLPSNLQVLQIVNCKKLVIGRKEWHLQRLPCLIEL

Gene3D: G3DSA:3.80.10.10
1105-1245 G3DSA:3.80.10.10

SLKTLSSQHLKSLTSLQYLRIANLPQIQSLLEPGRLPSSLSELHLYRHHELHSLGLCHLTSLQSLHIGNCHNLQSLSESALPSSLSKLTIYDCPNLQSLSKSVLPSSLSELDISHCPNLQSLLVKGMPSSLSKLSISNCPL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox