PRGDB00047252 (disease resistance protein R3a-like protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein R3a-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 157280360 (EF613539)
Gene Class NL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, Others
Gene Species Solanum demissum

Comment?

Solanum demissum isolate 48G14 disease resistance protein R3a-like protein gene, partial cds.

DNA Sequence

TTGGTGGTGCATTTCTCTCTTCAGCTTTGAATGTTCTCTTTGATAGGCTTGCTCCTCAGGGTGATCTGCTCAACATGTTTCAGAAGCATAAGCATCATGTTCGGCTCTTAAAGAAGCTGAAAATGACTTTGCGTGGTCTTCAGATTGTGCTAAGTGATGCAGAGAATAAGCAAGCATCAAATCCATCTGTGCGTGACTGGCTTAATGAGCTTCGAGATGCTGTCGACTCTGCTGAAAACTTTATAGAAGAAGTCAATTATGAAGCTTTGAGGCTTAAGGTGGAAGGTCAGAATCTTGCAGAAACAAGCAACCAGCTAGTAAGTGACCTCAACCTTTGCTTGAGTGATGAATTTTTACTTAACATAGAGGACAAGTTGGAAGACACTATTGAAACATTAAAGGATTTGCAAGAGCAAATTGGTCTCCTTGGCTTAAAGGAGTATTTTGGTTCCACGAAACTAGAAACTAGAAGACCTTCAACTTCTGTGGATGATGAATCTGATATCTTTGGTAGACTGAGCGAAATAGAGGATTTGATTGACCGTTTATTGTCTGAAGATGCGAGTGGGAAAAAGCTGACAGTAGTTCCTATTGTTGGAATGGGCGGCCTGGGTAAGACACCACTTGCTAAAGCCGTATACAATGATGAGAGGGTGAAGAACCATTTTGGTTTGAAAGCTTGGTATTGTGTTTCTGAGCCATATGATGCTTTGAGAATAACAAAAGGGTTACTTCAAGAAATTGGCAAATTTGACTCAAAGGATGTCCACAACAATCTTAATCAGCTNCAAGTCAAATTGAAGGAAAGCTTGAAGGAAAAGAAGTTCCTTATTGTTTTGGATGATGTGTGGAATGACAACTACAACGAGTGGGATGACTTGAGAAATATTTTTGTACAAGGAGAAATAGGAAGCAAGATCATTGTGACGACACGCAAAGAGAGTGCTGCCTTGATGATGGGAAATGAGAAAATTAGCATGGACAATTTGTCCACTGAAGCCTCTTGGTCTTTATTTAAAAGACATGCATTTGAAAACATGGATCCTATGGGACATCCGGAACTTGAAGAGGTCGGTAAACAAATTGCAGCTAAGTGCAAAGGACTGCCCTTAGCTCTGAAGACGCTCGCTGGCATGTTACGCTCCAAATCAGAGGTTGAAGAGTGGAAACGTATTTTGAGAAGTGAAATGTGGGAGCTGCGAGACAATGATATATTACCAGCGCTGATGTTGAGCTACAATGATCTTCCCGCACATTTAAAGCGATGTTTTTCCTTTTGTGCAATATTTCCTAAAGATTATCCATTTAGGAAAGAACAAGTTATTCATCTGTGGATTGCTAATGATATCGTACCACAGGAAGATGAGATAATTCAAGATTCAGGCAACCAGTACTTTCTCGAATTGAGATCAAGATCATTATTCGAAAAGGTCCCAAATCCTTCTAAAAGGAACATAGAGGAATTATTCTTAATGCATGACCTTGTCAATGATTTAGCCCAAATTGCATCTTCAAAACTTTGTATCAGGTTGGAAGAGAGCAAAGGATCTGATATGTTGGAAAAAAGTCGGCACTTATCTTATTCAATGGGAGAAGATGGTGAGTTTGAGAAATTGACACCTCTCTACAAATTGGAGCAGCTGAGGACATTGTTTCCGACATGTATTGATCTCACGGATTGTTATCACCCTCTAAGCAAGAGGGTGTTGCATAACATACTGCCAAGACTAAGATCCTTGAGGGTACTATCATTGTCTCATTACGAGATTAAGGAGTTGCCAAATGACTTGTTTATCAAATTAAAGCTCCTCAGATTTTTGGACCTTTCTTGTACAGAGATTAAAAAGTTGCCAGATTCCATATGTGCATTGTATAACTTGGAAACACTTATCCTGTCATCTTGTGTTAATCTTGAGGGGCTACCGCTGCAGATGGAGAAGTTGATTAACTTGCATCATCTTGACATAAGCAACACTTGTCGCTTGAAGATGCCACTACATCTGAGCAAGTTGAAAAGCCTCCAAGTGCTAGTGGGAGTAAAGTTTCTTCTAGGTGGTTGGAGGATGGAAGATTTGGGTGAAGCACAGAACTTGTATGGATCTCTATCAGTTTTAGAGTTGCAAAATGTGGTTGATAGAAGGGAAGCTGTGAAGGCAAAGATGAGGGAGAAGAATCATGCTGAGCAGTTATCTTTGGAGTGGAGTGAAAGTAGTAGTGCCGACAATTCAAAAACTGAAAGAGACATTCTTGATGAGCTACGCCCACATAAAAACATAAAAGAAGTCGAAATCACCGGATATAGAGGGACAATATTTCCGAATTGGCTAGCTGATCCTTTGTTTCTTAAGCTAGAACAGCTGTCTATTGATAACTGTAAGAACTGTTTTTCCTTGCCAGCACTAGGACAGCTTCCTTGTTTGAAAATCCTTTCCATTAGAGGGATGCATGGAATAACAGAGGTGACGGAAGAATTCTATGGTTGTTTGTCGTCCAAAAAGCCTTTTAACTGTCTTGAGAAGCTTGTATTTGAAGATATGGCGGAGTGGAAGAAATGGCACGTACTAGGAAGTGGAGAGTTCCCTATACTTGAGAACCTTTTAATTAAAAATTGCCCTGAACTCAGTTTGGAGACACCCATGCAACTTTCATGTTTAAAAAGGTTTAAAGTTGTTGGTTCTTCTAAGGTTGGAGTTGTTTTTGATGATGCTCAACTGTTAAAATCCCAACTTGAGGGAACGAAGGAGATTGAGGAATTAGATATTAGGGACTGTAACTCTCTTACCTCCTTTCCTTTTAGCATACTGCCCACTACCTTGAAGACAATAAGGATATCTGGTTGCCAGAAATTGAAATTGGATCCGCCAGTTGGTGAGATGAGTATGTTTCTCGAGGAACTGAATGTGGAAAAATGTGATTGTATAGATGATATATCAGTTGTAGAGTTGCTCCCAAGAGCACGCATATTGGATGTATCTGATTTCCAGAACCTTACTAGGTTTTTGATTCCTACTGTCACTGAAAGTCTCTCTATTTGGTATTGTGCGAATGTTGAAAAACTATCGGTGGCATGGGGGACCCAGATGACGTTTTTGCATATTTGGGACTGTAATAAGTTGAAGTGGCTGCCAGAACGTATGCAGGAACTCCTTCCATCTCTTAATACACTGCATCTGCTTGGATGTCCAGAAATAGAGTCCTTTCCTGAAGGAGGATTGCCCTTCAATTTACAAATACTTGTGATCGTCAACTGCCA


Protein sequences

Name Description Sequence
disease resistance protein R3a-like protein disease resistance protein R3a-like protein [Solanum demissum].

GGAFLSSALNVLFDRLAPQGDLLNMFQKHKHHVRLLKKLKMTLRGLQIVLSDAENKQASNPSVRDWLNELRDAVDSAENFIEEVNYEALRLKVEGQNLAETSNQLVSDLNLCLSDEFLLNIEDKLEDTIETLKDLQEQIGLLGLKEYFGSTKLETRRPSTSVDDESDIFGRLSEIEDLIDRLLSEDASGKKLTVVPIVGMGGLGKTPLAKAVYNDERVKNHFGLKAWYCVSEPYDALRITKGLLQEIGKFDSKDVHNNLNQLQVKLKESLKEKKFLIVLDDVWNDNYNEWDDLRNIFVQGEIGSKIIVTTRKESAALMMGNEKISMDNLSTEASWSLFKRHAFENMDPMGHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEMWELRDNDILPALMLSYNDLPAHLKRCFSFCAIFPKDYPFRKEQVIHLWIANDIVPQEDEIIQDSGNQYFLELRSRSLFEKVPNPSKRNIEELFLMHDLVNDLAQIASSKLCIRLEESKGSDMLEKSRHLSYSMGEDGEFEKLTPLYKLEQLRTLFPTCIDLTDCYHPLSKRVLHNILPRLRSLRVLSLSHYEIKELPNDLFIKLKLLRFLDLSCTEIKKLPDSICALYNLETLILSSCVNLEGLPLQMEKLINLHHLDISNTCRLKMPLHLSKLKSLQVLVGVKFLLGGWRMEDLGEAQNLYGSLSVLELQNVVDRREAVKAKMREKNHAEQLSLEWSESSSADNSKTERDILDELRPHKNIKEVEITGYRGTIFPNWLADPLFLKLEQLSIDNCKNCFSLPALGQLPCLKILSIRGMHGITEVTEEFYGCLSSKKPFNCLEKLVFEDMAEWKKWHVLGSGEFPILENLLIKNCPELSLETPMQLSCLKRFKVVGSSKVGVVFDDAQLLKSQLEGTKEIEELDIRDCNSLTSFPFSILPTTLKTIRISGCQKLKLDPPVGEMSMFLEELNVEKCDCIDDISVVELLPRARILDVSDFQNLTRFLIPTVTESLSIWYCANVEKLSVAWGTQMTFLHIWDCNKLKWLPERMQELLPSLNTLHLLGCPEIESFPEGGLPFNLQILVIVNC

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
7-873 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SALNVLFDRLAPQGDLLNMFQKHKHHVRLLKKLKMTLRGLQIVLSDAENKQASNPSVRDWLNELRDAVDSAENFIEEVNYEALRLKVEGQNLAETSNQLVSDLNLCLSDEFLLNIEDKLEDTIETLKDLQEQIGLLGLKEYFGSTKLETRRPSTSVDDESDIFGRLSEIEDLIDRLLSEDASGKKLTVVPIVGMGGLGKTPLAKAVYNDERVKNHFGLKAWYCVSEPYDALRITKGLLQEIGKFDSKDVHNNLNQLQVKLKESLKEKKFLIVLDDVWNDNYNEWDDLRNIFVQGEIGSKIIVTTRKESAALMMGNEKISMDNLSTEASWSLFKRHAFENMDPMGHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEMWELRDNDILPALMLSYNDLPAHLKRCFSFCAIFPKDYPFRKEQVIHLWIANDIVPQEDEIIQDSGNQYFLELRSRSLFEKVPNPSKRNIEELFLMHDLVNDLAQIASSKLCIRLEESKGSDMLEKSRHLSYSMGEDGEFEKLTPLYKLEQLRTLFPTCIDLTDCYHPLSKRVLHNILPRLRSLRVLSLSHYEIKELPNDLFIKLKLLRFLDLSCTEIKKLPDSICALYNLETLILSSCVNLEGLPLQMEKLINLHHLDISNTCRLKMPLHLSKLKSLQVLVGVKFLLGGWRMEDLGEAQNLYGSLSVLELQNVVDRREAVKAKMREKNHAEQLSLEWSESSSADNSKTERDILDELRPHKNIKEVEITGYRGTIFPNWLADPLFLKLEQLSIDNCKNCFSLPALGQLPCLKILSIRGMHGITEVTEEFYGCLSSKKPFNCLEKLVFEDMAEWKKWHVLGSGEFPILENLLIKNCPEL

HMMPanther: PTHR23155:SF236
7-873 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

SALNVLFDRLAPQGDLLNMFQKHKHHVRLLKKLKMTLRGLQIVLSDAENKQASNPSVRDWLNELRDAVDSAENFIEEVNYEALRLKVEGQNLAETSNQLVSDLNLCLSDEFLLNIEDKLEDTIETLKDLQEQIGLLGLKEYFGSTKLETRRPSTSVDDESDIFGRLSEIEDLIDRLLSEDASGKKLTVVPIVGMGGLGKTPLAKAVYNDERVKNHFGLKAWYCVSEPYDALRITKGLLQEIGKFDSKDVHNNLNQLQVKLKESLKEKKFLIVLDDVWNDNYNEWDDLRNIFVQGEIGSKIIVTTRKESAALMMGNEKISMDNLSTEASWSLFKRHAFENMDPMGHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEMWELRDNDILPALMLSYNDLPAHLKRCFSFCAIFPKDYPFRKEQVIHLWIANDIVPQEDEIIQDSGNQYFLELRSRSLFEKVPNPSKRNIEELFLMHDLVNDLAQIASSKLCIRLEESKGSDMLEKSRHLSYSMGEDGEFEKLTPLYKLEQLRTLFPTCIDLTDCYHPLSKRVLHNILPRLRSLRVLSLSHYEIKELPNDLFIKLKLLRFLDLSCTEIKKLPDSICALYNLETLILSSCVNLEGLPLQMEKLINLHHLDISNTCRLKMPLHLSKLKSLQVLVGVKFLLGGWRMEDLGEAQNLYGSLSVLELQNVVDRREAVKAKMREKNHAEQLSLEWSESSSADNSKTERDILDELRPHKNIKEVEITGYRGTIFPNWLADPLFLKLEQLSIDNCKNCFSLPALGQLPCLKILSIRGMHGITEVTEEFYGCLSSKKPFNCLEKLVFEDMAEWKKWHVLGSGEFPILENLLIKNCPEL

superfamily: SSF52540
151-402 SSF52540

TKLETRRPSTSVDDESDIFGRLSEIEDLIDRLLSEDASGKKLTVVPIVGMGGLGKTPLAKAVYNDERVKNHFGLKAWYCVSEPYDALRITKGLLQEIGKFDSKDVHNNLNQLQVKLKESLKEKKFLIVLDDVWNDNYNEWDDLRNIFVQGEIGSKIIVTTRKESAALMMGNEKISMDNLSTEASWSLFKRHAFENMDPMGHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEMWELRDN

Gene3D: G3DSA:3.40.50.300
165-298 G3DSA:3.40.50.300

ESDIFGRLSEIEDLIDRLLSEDASGKKLTVVPIVGMGGLGKTPLAKAVYNDERVKNHFGLKAWYCVSEPYDALRITKGLLQEIGKFDSKDVHNNLNQLQVKLKESLKEKKFLIVLDDVWNDNYNEWDDLRNIFV

HMMPfam: PF00931
IPR002182
173-454 NB-ARC,NBS
NB-ARC

SEIEDLIDRLLSEDASGKKLTVVPIVGMGGLGKTPLAKAVYNDERVKNHFGLKAWYCVSEPYDALRITKGLLQEIGKFDSKDVHNNLNQLQVKLKESLKEKKFLIVLDDVWNDNYNEWDDLRNIFVQGEIGSKIIVTTRKESAALMMGNEKISMDNLSTEASWSLFKRHAFENMDPMGHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEMWELRDNDILPALMLSYNDLPAHLKRCFSFCAIFPKDYPFRKEQVIHLWIANDIVPQED

FPrintScan: PR00364
IPR000767
194-209 DISEASERSIST
Disease resistance protein

VVPIVGMGGLGKTPLA

FPrintScan: PR00364
IPR000767
269-283 DISEASERSIST
Disease resistance protein

SLKEKKFLIVLDDVW

FPrintScan: PR00364
IPR000767
365-379 DISEASERSIST
Disease resistance protein

CKGLPLALKTLAGML

superfamily: SSF52058
490-994 SSF52058,LRR

LMHDLVNDLAQIASSKLCIRLEESKGSDMLEKSRHLSYSMGEDGEFEKLTPLYKLEQLRTLFPTCIDLTDCYHPLSKRVLHNILPRLRSLRVLSLSHYEIKELPNDLFIKLKLLRFLDLSCTEIKKLPDSICALYNLETLILSSCVNLEGLPLQMEKLINLHHLDISNTCRLKMPLHLSKLKSLQVLVGVKFLLGGWRMEDLGEAQNLYGSLSVLELQNVVDRREAVKAKMREKNHAEQLSLEWSESSSADNSKTERDILDELRPHKNIKEVEITGYRGTIFPNWLADPLFLKLEQLSIDNCKNCFSLPALGQLPCLKILSIRGMHGITEVTEEFYGCLSSKKPFNCLEKLVFEDMAEWKKWHVLGSGEFPILENLLIKNCPELSLETPMQLSCLKRFKVVGSSKVGVVFDDAQLLKSQLEGTKEIEELDIRDCNSLTSFPFSILPTTLKTIRISGCQKLKLDPPVGEMSMFLEELNVEKCDCIDDISVVELLPRARILDVSDFQ

Gene3D: G3DSA:3.80.10.10
569-676 G3DSA:3.80.10.10

LHNILPRLRSLRVLSLSHYEIKELPNDLFIKLKLLRFLDLSCTEIKKLPDSICALYNLETLILSSCVNLEGLPLQMEKLINLHHLDISNTCRLKMPLHLSKLKSLQVL

FPrintScan: PR00364
IPR000767
621-637 DISEASERSIST
Disease resistance protein

CALYNLETLILSSCVNL

Gene3D: G3DSA:3.80.10.10
741-887 G3DSA:3.80.10.10

NSKTERDILDELRPHKNIKEVEITGYRGTIFPNWLADPLFLKLEQLSIDNCKNCFSLPALGQLPCLKILSIRGMHGITEVTEEFYGCLSSKKPFNCLEKLVFEDMAEWKKWHVLGSGEFPILENLLIKNCPELSLETPMQLSCLKRF

Gene3D: G3DSA:3.80.10.10
903-1068 G3DSA:3.80.10.10

QLLKSQLEGTKEIEELDIRDCNSLTSFPFSILPTTLKTIRISGCQKLKLDPPVGEMSMFLEELNVEKCDCIDDISVVELLPRARILDVSDFQNLTRFLIPTVTESLSIWYCANVEKLSVAWGTQMTFLHIWDCNKLKWLPERMQELLPSLNTLHLLGCPEIESFPE

superfamily: SSF52058
1006-1083 SSF52058,LRR

ESLSIWYCANVEKLSVAWGTQMTFLHIWDCNKLKWLPERMQELLPSLNTLHLLGCPEIESFPEGGLPFNLQILVIVNC






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox