PRGDB00047253 (disease resistance protein R3a-like protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein R3a-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 157280357 (EF613537)
Gene Class NL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, Others
Gene Species Solanum demissum

Comment?

Solanum demissum isolate 439G3a disease resistance protein R3a-like protein gene, partial cds.

DNA Sequence

ATGTTCTCTTTGATAGGCTTGCTCCTCACGGTGATCTTCTCAACATGTTTCAGAAGCATAAGGATCATGTTCAGCTTTTAAAGAAGCTGAAAATGACTTTGCGTGGTCTTCAGATTGTGCTAAGTGATGCAGAGAATAAGCAGGCATCAAATCCATCTGTGAGAGACTGGCTTAATGAGCTTCGAGATGCTGTGGACGCTGCTGAAAACTTAATAGAAGAAGTTAATTATCAAGTGTTGAGGCTTAAGGTGGAAGGTCAGCATCAAAATCTTGCAGAAACAGGCAACCAGCAAGTAAGTGACCTCAACCTTTGCTTGAGTGATGAATTTTTCCTTAACATAAAGGACAAGTTGGAAGACACTATTGAAACATTAAAGGATTTGCAAGAGCAAATTGGTCTCCTTGGCTTAAAGGAGTATTTTGGTTCCACGAAACAAGAAACTAGAAGACCTTCAACTTCTGTGGATGATGAATCTGATATCTTTGGTAGGCAGAGGGAAATAGATGATTTGATTGACCGTTTATTGTCTGAAGATGCAAGTGGAAAAAAGCTGACAGTAGTTCCTATTGTTGGAATGGGCGGCCTGGGTAAGACAACACTTGCTAAAGTCATTTACAATGATGAGAGGGTGAAGAGCCATTTTGGTTTGAAAGGTTGGTATTGTGTTTCTGAGGAATATGATGCTTTGGGAATAGCGAAAGGGTTGCTTCAAGAAATTGGCAAATTTGACTCGCAGGATGTCTACAACAATCTTAATCAGCTTCAAGTCAAATTGAAGGAAAGCTTGAAGGGAAAGAAGTTCCTTATTGTTTTGGATGATGTCTGGAATGACAACTACAACGAGTGGGATGACTTGAGAAATATTTTTGTACAAGGAGATATAGGAAGTAAGATCATTGTGACAACACGCAAAGGGAGTGTTGCCTTGATGATGGGAAATAAGCAAATTAGCATGAACAATTTGTCTACTGAAGCCTCTTGGTCTTTATTTAAAAGACATGCATTTGAAAACATGGATCCTATGGGACATCCGGAACTTGAAGAGGTCGGAAAACAAATTGCAGCTAAGTGCAAAGGACTGCCCTTAGCTCTGAAGACGCTCGCTGGCATGTTACGCTCCAAATCAGAGGTTGAAGAGTGGAAACGTATTTTGAGAAGTGAAATATGGGAGCTGCCACACAATGACATATTACCAGCATTGATATTGAGCTACAATGATCTTCCTGCTCATTTAAAGCGGTGTTTTTCCTATTGTGCAATATTTCCTAAAGATTATCCATTTAGGAAAGAACAAGTTATTCATCTGTGGATTGCCAATGGTCTCGTACCACATGGAGATGAAATAATTGAAGATTCAGGCAACCAGTACTTTCTGGAGTTGAGATCAAGATCATTATTTGAAAGGGTCCCTAATCCTTCTGAACTGAACATAGAGAGTTTATTCTTAATGCATGACCTTGTCAATGATTTAGCCAAAATTGCATCTTCAAAACTTTGTATCAGGTTGGAAGAGAGCCAAGGATCTCATATGTTGGAACAAAGTCGACACTTATCATATTCAATGGGATATGGTGGTGAGTTTGAGAAATTGACACCCCTCTACAAATTGGAGCAGCTGAGGACATTGCTTCCGACATGTATTAATTTCATGGATCCTATTTTCCCTCTAAGCAAGAGGGTGCTGCATAACATATTGCCAAGGCTAACATCCTTAAGGGCATTATCGTTGTCATGGTATGAGATTGTTGAGTTGCCAAATGACTTATTTATCGAATTAAAGCTCCTCAGATTTTTGGACCTTTCTCAGACAACGATTGAAAAGTTGCCTGATTCCATTTGTGTATTGTATAACTTAGAGACACTTCTCCTGTCAGATTGTGATTATCTTGAGGAGCTACCGATGCAGATGGAGAAGTTGATCAACTTGCATCATCTTGACATAAGCAACACTTCTCTCTTGAAGATGCCGCTACATCTGATCAAGTTGAAAAGCCTCCAAGTCCTAGTGGGAGCCAAGTTTCTTCTCGGTGGTTTTAGAATGGAAGATTTGGGTGAAGCACAGAACTTGTATGGATCTCTATCTGTTTTAGAGTTGCAAAATGTGGTTGATAGAAGGGAAGCTGTGAAGGCAAAGATGAGGGAGAAGAATCATGTTGACAAGTTATCATTGGAGTGGAGTGAAAGTAGTAATGCCGACAATTCACAAACAGAAAGAGACATTCTTGATGAGCTACGCCCACATAAAAACATAAAAGAAGTCGAAATCACTGGATATAGAGGGACAACATTTCCCAATTGGCTAGCTGATCCTTTGTTTCTTAAGCTGGCGAAATTGTCTCTTAGCTACTGCAAGGACTGCTATTCCTTGCCAGCACTTGGACGGCTCCCTTCTTTGAAAATCCTTTCTGTTAAAGGGATGCATGGAATAACAGAGGTGACGGAAGAATTCTATGGCAGTCTGTCCTCCAAAAAGCCTTTTAACTGTCTTGAGAAGCTTGAATTTAAAGATATGCCGGAGTGGAAGCAATGGGACCTACTAGGAAGTGGAGAGTTCCCTATACTTGAGAAGCTTTTGATTGAAAATTGCCCTGAACTCAGTTTGGAGACGGTACCCATCCAACTTTCAAGTTTAAAAAGTTTTGAAGTAATTGGTTCTCCCATGGTTGGAGTTGTTTTTGAGGGAATGAAGCAGATTGAGGAATTACGTATTAGTGATTGTAACTCTGTTACCTCCTTTCCTTTTAGCATACTGCCCACTACCTTGAAGACAATAGGGATATCTAATTGCCAGAAATTGAAATTGGAACAGCCAGTTGGTGAGATGAGTATGTTTCTCGAGGAATTGACACTGGAGAACTGTGATTGTATAGATGATATATCACCTGAGTTGCTCCCAACAGCACGTCATTTGTGTGTATATGATTGCCACAACCTTACTAGGTTTTTGATTCCTACTGCCACTGAAACTCTCTTTATTGGGAATTGTGAGAATGTTGAAATACTTTCGGTGGCATGTGGGGGGACCCAGATGACGTTTTTGAATATTTGGGAATGTAAGAAGCTGAAGTGGCTGCCAGAACGTATGCAGGAACTCCTTCCATCTCTTAAGGATCTGCATCTGTATGGATGTCCCGAAATAGAGTCCTTTCCTGAAGGAGGATTGCCCTTCAATTTACAACAACTTCATATCTACAATTGCAAGAAACTGGTGAACGGCCGAAAGGAGTGGCATTTACAGAGACTCCCCTGTCTCACAGAGTTACAGATCTACCATGATGGCAGTGACGAAGAGATTGTTGGTGGTGAGAATTGGGAGTTGCCTTCCTCTATTCAAACACTTTATATAGACAATCTGAAAACATTAAGCAGCCAACACCTCAAAAGACTCATCTCTCTTCAATATCTATGTATTGAGGGTAATGTACCTCAAATTCAGTCCATGCTGGAACAAGGCCAGTTTTCGCACCTCACTTCGCTTCAAAGTCTACAAATCATGAATTTCCCTAATCTCCAATCACTTCCTGAAT


Protein sequences

Name Description Sequence
disease resistance protein R3a-like protein disease resistance protein R3a-like protein [Solanum demissum].

VLFDRLAPHGDLLNMFQKHKDHVQLLKKLKMTLRGLQIVLSDAENKQASNPSVRDWLNELRDAVDAAENLIEEVNYQVLRLKVEGQHQNLAETGNQQVSDLNLCLSDEFFLNIKDKLEDTIETLKDLQEQIGLLGLKEYFGSTKQETRRPSTSVDDESDIFGRQREIDDLIDRLLSEDASGKKLTVVPIVGMGGLGKTTLAKVIYNDERVKSHFGLKGWYCVSEEYDALGIAKGLLQEIGKFDSQDVYNNLNQLQVKLKESLKGKKFLIVLDDVWNDNYNEWDDLRNIFVQGDIGSKIIVTTRKGSVALMMGNKQISMNNLSTEASWSLFKRHAFENMDPMGHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHNDILPALILSYNDLPAHLKRCFSYCAIFPKDYPFRKEQVIHLWIANGLVPHGDEIIEDSGNQYFLELRSRSLFERVPNPSELNIESLFLMHDLVNDLAKIASSKLCIRLEESQGSHMLEQSRHLSYSMGYGGEFEKLTPLYKLEQLRTLLPTCINFMDPIFPLSKRVLHNILPRLTSLRALSLSWYEIVELPNDLFIELKLLRFLDLSQTTIEKLPDSICVLYNLETLLLSDCDYLEELPMQMEKLINLHHLDISNTSLLKMPLHLIKLKSLQVLVGAKFLLGGFRMEDLGEAQNLYGSLSVLELQNVVDRREAVKAKMREKNHVDKLSLEWSESSNADNSQTERDILDELRPHKNIKEVEITGYRGTTFPNWLADPLFLKLAKLSLSYCKDCYSLPALGRLPSLKILSVKGMHGITEVTEEFYGSLSSKKPFNCLEKLEFKDMPEWKQWDLLGSGEFPILEKLLIENCPELSLETVPIQLSSLKSFEVIGSPMVGVVFEGMKQIEELRISDCNSVTSFPFSILPTTLKTIGISNCQKLKLEQPVGEMSMFLEELTLENCDCIDDISPELLPTARHLCVYDCHNLTRFLIPTATETLFIGNCENVEILSVACGGTQMTFLNIWECKKLKWLPERMQELLPSLKDLHLYGCPEIESFPEGGLPFNLQQLHIYNCKKLVNGRKEWHLQRLPCLTELQIYHDGSDEEIVGGENWELPSSIQTLYIDNLKTLSSQHLKRLISLQYLCIEGNVPQIQSMLEQGQFSHLTSLQSLQIMNFPNLQSLPE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
25-882 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LLKKLKMTLRGLQIVLSDAENKQASNPSVRDWLNELRDAVDAAENLIEEVNYQVLRLKVEGQHQNLAETGNQQVSDLNLCLSDEFFLNIKDKLEDTIETLKDLQEQIGLLGLKEYFGSTKQETRRPSTSVDDESDIFGRQREIDDLIDRLLSEDASGKKLTVVPIVGMGGLGKTTLAKVIYNDERVKSHFGLKGWYCVSEEYDALGIAKGLLQEIGKFDSQDVYNNLNQLQVKLKESLKGKKFLIVLDDVWNDNYNEWDDLRNIFVQGDIGSKIIVTTRKGSVALMMGNKQISMNNLSTEASWSLFKRHAFENMDPMGHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHNDILPALILSYNDLPAHLKRCFSYCAIFPKDYPFRKEQVIHLWIANGLVPHGDEIIEDSGNQYFLELRSRSLFERVPNPSELNIESLFLMHDLVNDLAKIASSKLCIRLEESQGSHMLEQSRHLSYSMGYGGEFEKLTPLYKLEQLRTLLPTCINFMDPIFPLSKRVLHNILPRLTSLRALSLSWYEIVELPNDLFIELKLLRFLDLSQTTIEKLPDSICVLYNLETLLLSDCDYLEELPMQMEKLINLHHLDISNTSLLKMPLHLIKLKSLQVLVGAKFLLGGFRMEDLGEAQNLYGSLSVLELQNVVDRREAVKAKMREKNHVDKLSLEWSESSNADNSQTERDILDELRPHKNIKEVEITGYRGTTFPNWLADPLFLKLAKLSLSYCKDCYSLPALGRLPSLKILSVKGMHGITEVTEEFYGSLSSKKPFNCLEKLEFKDMPEWKQWDLLGSGEFPILEKLLIENCPELSLETVPIQLSSLKSFEV

HMMPanther: PTHR23155:SF236
25-882 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

LLKKLKMTLRGLQIVLSDAENKQASNPSVRDWLNELRDAVDAAENLIEEVNYQVLRLKVEGQHQNLAETGNQQVSDLNLCLSDEFFLNIKDKLEDTIETLKDLQEQIGLLGLKEYFGSTKQETRRPSTSVDDESDIFGRQREIDDLIDRLLSEDASGKKLTVVPIVGMGGLGKTTLAKVIYNDERVKSHFGLKGWYCVSEEYDALGIAKGLLQEIGKFDSQDVYNNLNQLQVKLKESLKGKKFLIVLDDVWNDNYNEWDDLRNIFVQGDIGSKIIVTTRKGSVALMMGNKQISMNNLSTEASWSLFKRHAFENMDPMGHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHNDILPALILSYNDLPAHLKRCFSYCAIFPKDYPFRKEQVIHLWIANGLVPHGDEIIEDSGNQYFLELRSRSLFERVPNPSELNIESLFLMHDLVNDLAKIASSKLCIRLEESQGSHMLEQSRHLSYSMGYGGEFEKLTPLYKLEQLRTLLPTCINFMDPIFPLSKRVLHNILPRLTSLRALSLSWYEIVELPNDLFIELKLLRFLDLSQTTIEKLPDSICVLYNLETLLLSDCDYLEELPMQMEKLINLHHLDISNTSLLKMPLHLIKLKSLQVLVGAKFLLGGFRMEDLGEAQNLYGSLSVLELQNVVDRREAVKAKMREKNHVDKLSLEWSESSNADNSQTERDILDELRPHKNIKEVEITGYRGTTFPNWLADPLFLKLAKLSLSYCKDCYSLPALGRLPSLKILSVKGMHGITEVTEEFYGSLSSKKPFNCLEKLEFKDMPEWKQWDLLGSGEFPILEKLLIENCPELSLETVPIQLSSLKSFEV

superfamily: SSF52540
143-394 SSF52540

TKQETRRPSTSVDDESDIFGRQREIDDLIDRLLSEDASGKKLTVVPIVGMGGLGKTTLAKVIYNDERVKSHFGLKGWYCVSEEYDALGIAKGLLQEIGKFDSQDVYNNLNQLQVKLKESLKGKKFLIVLDDVWNDNYNEWDDLRNIFVQGDIGSKIIVTTRKGSVALMMGNKQISMNNLSTEASWSLFKRHAFENMDPMGHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHN

Gene3D: G3DSA:3.40.50.300
157-287 G3DSA:3.40.50.300

ESDIFGRQREIDDLIDRLLSEDASGKKLTVVPIVGMGGLGKTTLAKVIYNDERVKSHFGLKGWYCVSEEYDALGIAKGLLQEIGKFDSQDVYNNLNQLQVKLKESLKGKKFLIVLDDVWNDNYNEWDDLRN

HMMPfam: PF00931
IPR002182
163-446 NB-ARC,NBS
NB-ARC

RQREIDDLIDRLLSEDASGKKLTVVPIVGMGGLGKTTLAKVIYNDERVKSHFGLKGWYCVSEEYDALGIAKGLLQEIGKFDSQDVYNNLNQLQVKLKESLKGKKFLIVLDDVWNDNYNEWDDLRNIFVQGDIGSKIIVTTRKGSVALMMGNKQISMNNLSTEASWSLFKRHAFENMDPMGHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHNDILPALILSYNDLPAHLKRCFSYCAIFPKDYPFRKEQVIHLWIANGLVPHGD

FPrintScan: PR00364
IPR000767
186-201 DISEASERSIST
Disease resistance protein

VVPIVGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
261-275 DISEASERSIST
Disease resistance protein

SLKGKKFLIVLDDVW

FPrintScan: PR00364
IPR000767
357-371 DISEASERSIST
Disease resistance protein

CKGLPLALKTLAGML

superfamily: SSF52058
482-976 SSF52058,LRR

LMHDLVNDLAKIASSKLCIRLEESQGSHMLEQSRHLSYSMGYGGEFEKLTPLYKLEQLRTLLPTCINFMDPIFPLSKRVLHNILPRLTSLRALSLSWYEIVELPNDLFIELKLLRFLDLSQTTIEKLPDSICVLYNLETLLLSDCDYLEELPMQMEKLINLHHLDISNTSLLKMPLHLIKLKSLQVLVGAKFLLGGFRMEDLGEAQNLYGSLSVLELQNVVDRREAVKAKMREKNHVDKLSLEWSESSNADNSQTERDILDELRPHKNIKEVEITGYRGTTFPNWLADPLFLKLAKLSLSYCKDCYSLPALGRLPSLKILSVKGMHGITEVTEEFYGSLSSKKPFNCLEKLEFKDMPEWKQWDLLGSGEFPILEKLLIENCPELSLETVPIQLSSLKSFEVIGSPMVGVVFEGMKQIEELRISDCNSVTSFPFSILPTTLKTIGISNCQKLKLEQPVGEMSMFLEELTLENCDCIDDISPELLPTARHLCVYDCH

Gene3D: G3DSA:3.80.10.10
560-676 G3DSA:3.80.10.10

VLHNILPRLTSLRALSLSWYEIVELPNDLFIELKLLRFLDLSQTTIEKLPDSICVLYNLETLLLSDCDYLEELPMQMEKLINLHHLDISNTSLLKMPLHLIKLKSLQVLVGAKFLLG

FPrintScan: PR00364
IPR000767
637-653 DISEASERSIST
Disease resistance protein

EKLINLHHLDISNTSLL

Gene3D: G3DSA:3.80.10.10
738-879 G3DSA:3.80.10.10

RDILDELRPHKNIKEVEITGYRGTTFPNWLADPLFLKLAKLSLSYCKDCYSLPALGRLPSLKILSVKGMHGITEVTEEFYGSLSSKKPFNCLEKLEFKDMPEWKQWDLLGSGEFPILEKLLIENCPELSLETVPIQLSSLKS

Gene3D: G3DSA:3.80.10.10
880-1090 G3DSA:3.80.10.10

FEVIGSPMVGVVFEGMKQIEELRISDCNSVTSFPFSILPTTLKTIGISNCQKLKLEQPVGEMSMFLEELTLENCDCIDDISPELLPTARHLCVYDCHNLTRFLIPTATETLFIGNCENVEILSVACGGTQMTFLNIWECKKLKWLPERMQELLPSLKDLHLYGCPEIESFPEGGLPFNLQQLHIYNCKKLVNGRKEWHLQRLPCLTELQIY

superfamily: SSF52058
887-1175 SSF52058,LRR

MVGVVFEGMKQIEELRISDCNSVTSFPFSILPTTLKTIGISNCQKLKLEQPVGEMSMFLEELTLENCDCIDDISPELLPTARHLCVYDCHNLTRFLIPTATETLFIGNCENVEILSVACGGTQMTFLNIWECKKLKWLPERMQELLPSLKDLHLYGCPEIESFPEGGLPFNLQQLHIYNCKKLVNGRKEWHLQRLPCLTELQIYHDGSDEEIVGGENWELPSSIQTLYIDNLKTLSSQHLKRLISLQYLCIEGNVPQIQSMLEQGQFSHLTSLQSLQIMNFPNLQSLPE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox