PRGDB00047254 (disease resistance protein R3a-like protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein R3a-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 157280353 (EF613534)
Gene Class NL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, Others
Gene Species Solanum demissum

Comment?

Solanum demissum isolate 370H18 disease resistance protein R3a-like protein gene, partial cds.

DNA Sequence

TTGGTGGTGCATTTCTCTCTTCAGCTTTGAATGTTCTCTTTGATAGGCTTGCTCCTAACGGTGATCTGCTCAACATGTTTCGGAAGCATACAGATGATGTTCAGCTCTTTGAGAAGCTGGGGGACATTTTGCTTGGTCTTCAAATTGTGCTAAGTGATGCAGAGAATAAGAAAGCATCAAATCAATTTGTGAGCCAGTGGTTAAATAAGCTTCAGAGTGCTGTGGACGCTGCTGAAAACTTGATAGAACAAGTCAATTATGAAGCTTTGAGGCTTAAAGTGGAAGGTCATCTTCAAAATCTTGCAGAAACAAGCAACCAGCAAGTAAGTGACCTTAACCTGTGCTTGAGTGATGATTTCTTTCTTAACATAAAGAAGAAGTTGGAAGACACTATTAAAAAACTGGAGGTGTTGGAAAAGCAAATTGGTCGCCTTGGCTTAAAGGAGCATTTTGCTTCGATTAAACAAGAAACTAGAACACCTTCAACTTCTTTGGTTGATGATGCTGGTATCTTTGGAAGGAAGAATGAAATAGAGAATTTGATTGGCCGTTTATTGTCTAAGGATACAAAGGGAAAAAATCTGGCTGTAGTTCCTATTGTTGGAATGGGCGGCCTGGGTAAGACAACACTTGCTAAAGCGGTTTACAATGATGAGAGAGTGCAGAAACATTTTGGTTTGAAAGCTTGGTTTTGTGTTTCTGAGGCATATGATGCTTTCAAAATAACAAAAGGTTTACTTCAAGAAATTGGCTTAAAGGTTGATGACAATCTTAATCAGCTACAAGTCAAATTGAAGGAAAAGCTGAATGGAAAAAGGTTTCTTGTTGTCCTTGATGACATGTGGAATGATAACTATCCTGAGTGGGATGACTTGAGAAATCTTTTTCTACAAGGAGATATAGGAAGTAAGATCATTGTGACGACACGTAAAGAAAGTGTTGCCTTGATGATGGGTAGTGGGGCAATCTACATGGGAATTCTGTCTAGTGAAGACTCTTGGGCTCTATTCAAACGACATTCACTAGAAAATAGGGATCCTAAGGAAAATCCAGAATTTGAAGAGGTTGGAAAACAAATTGCAGACAAGTGCAAAGGGTTGCCTTTAGCTCTAAAAGCACTTGCTGGTATTTTACGCGGAAAATCAGAGGTGAATGAGTGGAGAGACATTTTAAGAAGTGAAATATGGGAGCTGTCTATTTGTTCGAATGGTATATTACCAGCGCTGATGCTGAGCTACAATGATCTTCCTGCACGTTTGAAGCAATGTTTTGCTTATTGTGCAATATATCCCAAAGATTATCAATTTTGCAAAGATCAAGTTATTCACCTGTGGATTGCTAATGGTCTGGTACAGCAGTTTCATTCAGGTAACCAATACTTTCTTGAGTTGAGATCAAGATCACTGTTCGAAATGGTCTCGGAGTCTTCTGAATCGAATTCAGAGAAATTCTTAATGCATGACCTTGTCAATGATTTGGCCCAAATTGCATCTTCAAATCTTTGTATAAGGTTGGAAGAGAACAAAGGATTGCATATGTTGGAACAATGTCGGCACATGTCCTACTTAATAGGAGAAGATGGTGACTTTGAGAAATTGAAATCACTCTTTAAATCAGAGCAGGTGAGGACATTACTTCCAATCAATATCCAGCTCTATTATTACAACATTCAGCTAAGCAGGAGGGTGCTGCATAACATATTGCCAAGACTAACATCCTTAAGGGCATTATCATTGTTAGGCTATAAGATTGTTGAGTTGCCAAATGACTTGTTTATCAAATTAAAGCTCCTCAGATATTTGGATATTTCTCAGACAAAGATTAAAAGGTTGCCAGATTCCATTTGTGTGTTGTATAACTTAGAGACACTTCTCCTGTCATCTTGTGATTGTCTTGAGGAGCTACCGCTGCAGATGGAGAAGTTGATTAACTTGCGTCATCTTGACATAAGCAACACTCGTCTCTTGAAGATGCCGCTACATCTGAGCAAGTTGAAAAGCCTCCAAGTGCTATTGGGAGCCAAATTTCTTCTTGGTGGTTTGAGTATGGAAGATTTGGGTGAAGCACAAAACTTGTATGGATCTCTATCAGTTGTAGAGTTGCAAAATGTGGTTGATAGAAGAGAAGCTGTGAAGGCAAAGATGAGGGAGAAGAATCATGTTGACAAGTTATCATTGGAGTGGAGTGAAAGTAGTAGTGCCGACAATTCACAAACTGAAAGAGATATACTTGATGAGCTACGCCCACATAAAAACATAAAAGAAGTCAAAATCATCGGATACAGAGGGACAACATTTCCGAATTGGCTAGCTGATCCTTTGTTTCTTAAGCTAGAACAGTTGTCTATTGATAACTGCAAGAATTGTTTTTCCTTGCCAGCACTAGGACAGCTTCCTTGTTTGAAAATCCTTTCCATTAGAGGGATGCATGGAATAACAGAGGTGACGGAAGAATTCTATAGCAGTTTGTCCTCAAAAAAGCCTTTTAACTGTCTTGAGAAGCTTGAATTTGTTGATATGCCGGTGTGGAAGCAATGGCACGTACTAGGAAGTGGAGATTTCCCTATACTTGAGAAGCTTTTCATTAAAAATTGCCCTGAACTCAGTTTGGAGACACCCATTCAACTTTCAAGTTTAAAAAGGTTTCAAGTTGTTGGTTCTTCTAAGGTTGGCGTTGTTTTTGATGATGCTCAACTGTTTAGATCCCAACTTGAGGGAATGAAGCAGATTGAGGCATTAAATATTAGTGATTGTAACTCTGTTATCTCCTTTCCTTATAGCATACTGCCCACTACCTTGAAGAGAATAACGATATCTCGTTGCCAGAAATTGAAATTGGATCCGCCAGTTGGTGAGATGAGTATGTTTCTGGAGTATTTGAGTCTGAAAGAATGTGATTGTATAGATGATATATCACCTGAGTTACTCCCAAGAGCACGCGAATTGTGGGTAGAGAATTGCCACAACCTTACTAGGTTTTTGATTCCTACTGCCACTGAAAGACTCAATATTCAGAATTGTGAGAATCTTGAAATACTTTTGGTGGCATCTGAGGGGACCCAGATGACGTATTTGAATATTTGGGGATGTAGGAAGCTGAAGTGGCTGCCAGAACGTATGCAGGAACTCCTTCCATCTCTAAAGGAACTGCGTCTTT


Protein sequences

Name Description Sequence
disease resistance protein R3a-like protein disease resistance protein R3a-like protein [Solanum demissum].

GGAFLSSALNVLFDRLAPNGDLLNMFRKHTDDVQLFEKLGDILLGLQIVLSDAENKKASNQFVSQWLNKLQSAVDAAENLIEQVNYEALRLKVEGHLQNLAETSNQQVSDLNLCLSDDFFLNIKKKLEDTIKKLEVLEKQIGRLGLKEHFASIKQETRTPSTSLVDDAGIFGRKNEIENLIGRLLSKDTKGKNLAVVPIVGMGGLGKTTLAKAVYNDERVQKHFGLKAWFCVSEAYDAFKITKGLLQEIGLKVDDNLNQLQVKLKEKLNGKRFLVVLDDMWNDNYPEWDDLRNLFLQGDIGSKIIVTTRKESVALMMGSGAIYMGILSSEDSWALFKRHSLENRDPKENPEFEEVGKQIADKCKGLPLALKALAGILRGKSEVNEWRDILRSEIWELSICSNGILPALMLSYNDLPARLKQCFAYCAIYPKDYQFCKDQVIHLWIANGLVQQFHSGNQYFLELRSRSLFEMVSESSESNSEKFLMHDLVNDLAQIASSNLCIRLEENKGLHMLEQCRHMSYLIGEDGDFEKLKSLFKSEQVRTLLPINIQLYYYNIQLSRRVLHNILPRLTSLRALSLLGYKIVELPNDLFIKLKLLRYLDISQTKIKRLPDSICVLYNLETLLLSSCDCLEELPLQMEKLINLRHLDISNTRLLKMPLHLSKLKSLQVLLGAKFLLGGLSMEDLGEAQNLYGSLSVVELQNVVDRREAVKAKMREKNHVDKLSLEWSESSSADNSQTERDILDELRPHKNIKEVKIIGYRGTTFPNWLADPLFLKLEQLSIDNCKNCFSLPALGQLPCLKILSIRGMHGITEVTEEFYSSLSSKKPFNCLEKLEFVDMPVWKQWHVLGSGDFPILEKLFIKNCPELSLETPIQLSSLKRFQVVGSSKVGVVFDDAQLFRSQLEGMKQIEALNISDCNSVISFPYSILPTTLKRITISRCQKLKLDPPVGEMSMFLEYLSLKECDCIDDISPELLPRARELWVENCHNLTRFLIPTATERLNIQNCENLEILLVASEGTQMTYLNIWGCRKLKWLPERMQELLPSLKELRL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF236
4-867 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

FLSSALNVLFDRLAPNGDLLNMFRKHTDDVQLFEKLGDILLGLQIVLSDAENKKASNQFVSQWLNKLQSAVDAAENLIEQVNYEALRLKVEGHLQNLAETSNQQVSDLNLCLSDDFFLNIKKKLEDTIKKLEVLEKQIGRLGLKEHFASIKQETRTPSTSLVDDAGIFGRKNEIENLIGRLLSKDTKGKNLAVVPIVGMGGLGKTTLAKAVYNDERVQKHFGLKAWFCVSEAYDAFKITKGLLQEIGLKVDDNLNQLQVKLKEKLNGKRFLVVLDDMWNDNYPEWDDLRNLFLQGDIGSKIIVTTRKESVALMMGSGAIYMGILSSEDSWALFKRHSLENRDPKENPEFEEVGKQIADKCKGLPLALKALAGILRGKSEVNEWRDILRSEIWELSICSNGILPALMLSYNDLPARLKQCFAYCAIYPKDYQFCKDQVIHLWIANGLVQQFHSGNQYFLELRSRSLFEMVSESSESNSEKFLMHDLVNDLAQIASSNLCIRLEENKGLHMLEQCRHMSYLIGEDGDFEKLKSLFKSEQVRTLLPINIQLYYYNIQLSRRVLHNILPRLTSLRALSLLGYKIVELPNDLFIKLKLLRYLDISQTKIKRLPDSICVLYNLETLLLSSCDCLEELPLQMEKLINLRHLDISNTRLLKMPLHLSKLKSLQVLLGAKFLLGGLSMEDLGEAQNLYGSLSVVELQNVVDRREAVKAKMREKNHVDKLSLEWSESSSADNSQTERDILDELRPHKNIKEVKIIGYRGTTFPNWLADPLFLKLEQLSIDNCKNCFSLPALGQLPCLKILSIRGMHGITEVTEEFYSSLSSKKPFNCLEKLEFVDMPVWKQWHVLGSGDFPILEKLFIKNCPEL

HMMPanther: PTHR23155
4-867 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FLSSALNVLFDRLAPNGDLLNMFRKHTDDVQLFEKLGDILLGLQIVLSDAENKKASNQFVSQWLNKLQSAVDAAENLIEQVNYEALRLKVEGHLQNLAETSNQQVSDLNLCLSDDFFLNIKKKLEDTIKKLEVLEKQIGRLGLKEHFASIKQETRTPSTSLVDDAGIFGRKNEIENLIGRLLSKDTKGKNLAVVPIVGMGGLGKTTLAKAVYNDERVQKHFGLKAWFCVSEAYDAFKITKGLLQEIGLKVDDNLNQLQVKLKEKLNGKRFLVVLDDMWNDNYPEWDDLRNLFLQGDIGSKIIVTTRKESVALMMGSGAIYMGILSSEDSWALFKRHSLENRDPKENPEFEEVGKQIADKCKGLPLALKALAGILRGKSEVNEWRDILRSEIWELSICSNGILPALMLSYNDLPARLKQCFAYCAIYPKDYQFCKDQVIHLWIANGLVQQFHSGNQYFLELRSRSLFEMVSESSESNSEKFLMHDLVNDLAQIASSNLCIRLEENKGLHMLEQCRHMSYLIGEDGDFEKLKSLFKSEQVRTLLPINIQLYYYNIQLSRRVLHNILPRLTSLRALSLLGYKIVELPNDLFIKLKLLRYLDISQTKIKRLPDSICVLYNLETLLLSSCDCLEELPLQMEKLINLRHLDISNTRLLKMPLHLSKLKSLQVLLGAKFLLGGLSMEDLGEAQNLYGSLSVVELQNVVDRREAVKAKMREKNHVDKLSLEWSESSSADNSQTERDILDELRPHKNIKEVKIIGYRGTTFPNWLADPLFLKLEQLSIDNCKNCFSLPALGQLPCLKILSIRGMHGITEVTEEFYSSLSSKKPFNCLEKLEFVDMPVWKQWHVLGSGDFPILEKLFIKNCPEL

Gene3D: G3DSA:3.30.830.10
IPR011237
39-110 Pept_M16_core
Peptidase M16, core

LGDILLGLQIVLSDAENKKASNQFVSQWLNKLQSAVDAAENLIEQVNYEALRLKVEGHLQNLAETSNQQVSD

superfamily: SSF52540
153-397 SSF52540

IKQETRTPSTSLVDDAGIFGRKNEIENLIGRLLSKDTKGKNLAVVPIVGMGGLGKTTLAKAVYNDERVQKHFGLKAWFCVSEAYDAFKITKGLLQEIGLKVDDNLNQLQVKLKEKLNGKRFLVVLDDMWNDNYPEWDDLRNLFLQGDIGSKIIVTTRKESVALMMGSGAIYMGILSSEDSWALFKRHSLENRDPKENPEFEEVGKQIADKCKGLPLALKALAGILRGKSEVNEWRDILRSEIWEL

HMMPfam: PF00931
IPR002182
173-454 NB-ARC,NBS
NB-ARC

RKNEIENLIGRLLSKDTKGKNLAVVPIVGMGGLGKTTLAKAVYNDERVQKHFGLKAWFCVSEAYDAFKITKGLLQEIGLKVDDNLNQLQVKLKEKLNGKRFLVVLDDMWNDNYPEWDDLRNLFLQGDIGSKIIVTTRKESVALMMGSGAIYMGILSSEDSWALFKRHSLENRDPKENPEFEEVGKQIADKCKGLPLALKALAGILRGKSEVNEWRDILRSEIWELSICSNGILPALMLSYNDLPARLKQCFAYCAIYPKDYQFCKDQVIHLWIANGLVQQFH

Gene3D: G3DSA:3.40.50.300
174-311 G3DSA:3.40.50.300

KNEIENLIGRLLSKDTKGKNLAVVPIVGMGGLGKTTLAKAVYNDERVQKHFGLKAWFCVSEAYDAFKITKGLLQEIGLKVDDNLNQLQVKLKEKLNGKRFLVVLDDMWNDNYPEWDDLRNLFLQGDIGSKIIVTTRKE

FPrintScan: PR00364
IPR000767
196-211 DISEASERSIST
Disease resistance protein

VVPIVGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
267-281 DISEASERSIST
Disease resistance protein

KLNGKRFLVVLDDMW

FPrintScan: PR00364
IPR000767
363-377 DISEASERSIST
Disease resistance protein

CKGLPLALKALAGIL

superfamily: SSF52058
517-949 SSF52058,LRR

RHMSYLIGEDGDFEKLKSLFKSEQVRTLLPINIQLYYYNIQLSRRVLHNILPRLTSLRALSLLGYKIVELPNDLFIKLKLLRYLDISQTKIKRLPDSICVLYNLETLLLSSCDCLEELPLQMEKLINLRHLDISNTRLLKMPLHLSKLKSLQVLLGAKFLLGGLSMEDLGEAQNLYGSLSVVELQNVVDRREAVKAKMREKNHVDKLSLEWSESSSADNSQTERDILDELRPHKNIKEVKIIGYRGTTFPNWLADPLFLKLEQLSIDNCKNCFSLPALGQLPCLKILSIRGMHGITEVTEEFYSSLSSKKPFNCLEKLEFVDMPVWKQWHVLGSGDFPILEKLFIKNCPELSLETPIQLSSLKRFQVVGSSKVGVVFDDAQLFRSQLEGMKQIEALNISDCNSVISFPYSILPTTLKRITISRCQKLKLDPPV

Gene3D: G3DSA:3.80.10.10
558-691 G3DSA:3.80.10.10

LSRRVLHNILPRLTSLRALSLLGYKIVELPNDLFIKLKLLRYLDISQTKIKRLPDSICVLYNLETLLLSSCDCLEELPLQMEKLINLRHLDISNTRLLKMPLHLSKLKSLQVLLGAKFLLGGLSMEDLGEAQNL

HMMPfam: PF13855
596-654 LRR_8,Leucine rich repeat

LLRYLDISQTKIKRLPDSICVLYNLETLLLSSCDCLEELPLQMEKLINLRHLDISNTRL

FPrintScan: PR00364
IPR000767
639-655 DISEASERSIST
Disease resistance protein

EKLINLRHLDISNTRLL

Gene3D: G3DSA:3.80.10.10
741-908 G3DSA:3.80.10.10

DILDELRPHKNIKEVKIIGYRGTTFPNWLADPLFLKLEQLSIDNCKNCFSLPALGQLPCLKILSIRGMHGITEVTEEFYSSLSSKKPFNCLEKLEFVDMPVWKQWHVLGSGDFPILEKLFIKNCPELSLETPIQLSSLKRFQVVGSSKVGVVFDDAQLFRSQLEGMKQ

superfamily: SSF52058
901-1051 SSF52058,LRR

SQLEGMKQIEALNISDCNSVISFPYSILPTTLKRITISRCQKLKLDPPVGEMSMFLEYLSLKECDCIDDISPELLPRARELWVENCHNLTRFLIPTATERLNIQNCENLEILLVASEGTQMTYLNIWGCRKLKWLPERMQELLPSLKELRL

Gene3D: G3DSA:3.80.10.10
909-1051 G3DSA:3.80.10.10

IEALNISDCNSVISFPYSILPTTLKRITISRCQKLKLDPPVGEMSMFLEYLSLKECDCIDDISPELLPRARELWVENCHNLTRFLIPTATERLNIQNCENLEILLVASEGTQMTYLNIWGCRKLKWLPERMQELLPSLKELRL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox