PRGDB00047256 (disease resistance protein R3a-like protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein R3a-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 157280348 (EF613531)
Gene Class NL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, Others
Gene Species Solanum demissum

Comment?

Solanum demissum isolate 286O21a disease resistance protein R3a-like protein gene, partial cds.

DNA Sequence

TGATCTGCTCAACATGTTTAAGAGGGACAAGCGTGATGTTCGGCTCTTAAAGAAGCTGAGGATGACTTTGCTTGGCCTTCAGGCTGTGTTATGTGATGCGGAGAATAAGAAAGCATCAAATCCATATGTGAGCCAGTGGCTTAATGAGCTTCAAGATGCTGTGGACGGCGCTGAAAACTTAATAGAAGAAGTCAATTATGAGGTTTTGAGACTAAAGGTGGAAGGTCAGAATCAAAACCTTGGAGAAACAAGCAATCAACAGGTAAGTGACTGCAACCTGTGCTTGAGTGATGATTTTTTTATTAACATAAAGGAGAAGTTGGAAGACACCATTGAAACATTGGAGGAGTTGGAAAAGCAAATTGGTCGCCTTGATCTAACAAAGTATCTTGATTCGGGTAAACAAGAAACAAGGGAATCTTCAACTTCTGTGGTTGATGAATCTGATATCTTAGGTAGGAAGAACGAAATAGAGGAATTGGTTGACCGTTTGTTGTCTGAGGATGGAAAAAATCTGACTGTAGTTCCTGTTGTTGGAATGGGGGGCGTGGGCAAGACAACACTTGCTAAAGCTGTTTACAATGATGAGAAGGTAAAAAACCATTTTGGTTTGAAAGCTTGGATCTGTGTGTCTGAACCATATGATATTCTCAGAATAACAAAGGAGTTACTTCAAGAATTTGGCTCAACGGTTGATAACAATCTGAATCAACTTCAAGTCAAATTGAAGGAGAGCTTAAAGGGAAAAAAGTTTCTTATTGTCCTAGATGATATCTGGAATGAAAACTATAAAGAGTGGGATGCCTTGAGAAATCTTTTTGTACAAGGAGATGTAGGAAGTAAGATCATTGTGACGACACGTAAGGAGAGTGTTGCCTTGATGATGGGTTGTGGGCCAATCAACGTGGGGACTCTGTCTAGTAAAGTCTCTTGGGATCTATTCAAGCGGCATTCGTTTGAAAATAGGGATCCTGAGGAACATCCAGAACTTGAAGAGGTTGGAATACAAATTGCACACAAGTGCAAAGGATTGCCTTTAGCTCTAAAGGCACTTGCTGGTATTTTACGCTCCAAATCAGAGGTGGATGAGTGGAGAGACATTTTAAGAAGTGAAATATGGGAGCTGCAAAGTCGTTCGAATGGAATCTTACCAGCATTGATGTTGAGCTATAATGATCTTCCTCCACAATTGAAGCGGTGTTTTGCTTTTTGTGCAATATATCCGAAAGATTATCTTTTTTGCAAAGAACAAGTTATTCATCTGTGGATTGCTAATGGTCTTGTACAGCAGTTGCATTCAGCTAACCATTACTTTCTCGAGTTGAGATCAAGATCATTGTTTGAAAAGGTCCGAGAGTCTTCTGAATGGAATCCGGGGGAATTCTTAATGCATGACCTTGTCAATGATTTGGCCCAAATTGTATCTTCAAATCTGTGTATGAGGTTGGAAGACATCGACGCATCACATATGTTGGAACGAACTCGACATTTGTCGTATTCAATGGGTGATGGTAATTTCGGTAAACTGAAAACCCTCAACAAATTGGAGCAATTGAGGACATTGCTTCCCATCAATATCCAGCGGCGTCCATTCCATCTTAACAAGAGGATGCTGCATGACATATTTCCAAGACTAATATCCCTAAGGGCACTATCACTGTCTCATTATGAGAATGATGAGTTGCCAAATGACTTGTTTATCAAATTAAAGCACCTAAGATTTTTGGACCTTTCTTGGACAAATATAAAAAAGTTGCCAGATTCAATTTGTGTACTGTACAACTTAGAGACACTTCTGTTGTCACGCTGTGTTTTTCTTAAGGAGCTACCTCTGCATATGGAAAAATTGATCAACTTGCGTCACCTTGACATTAGCAAAGCCAAATTGAAGACACCTCTACATCTGAGCAAGTTGAAAAGTCTCCATCTGCTAGTGGGAGCCAAGTTTCTTCTAGGTGGTCACGGTGGTTCGAGAATCGAACATTTGGGGGAACTACATAACTTGTATGGATCTCTATTAATTCTAGAGTTGCAACATGTGGTAGATAGAAGGGAATCTCCGAAGGCAAACATGAGGAAAAAGGAACATGTTGAAAGGTTATCTTTGAAGTGGAGCAGAAGTTTTGCTGACAATTCACAAACTGAAAATGACATACTTGATGAGCTACAACCAAATGCAAACATAAAAGAAATCAAAATCGCCGGATATAGAGGGACAAAATTTCCAAATTGGCTAGCTGATCATTCATTTCATAAGCTAATAGAAGTGTCTCTTAGCTACTGCAAGGACTGTGATTCCTTGCCAGCACTAGGACAGCTTCCTTGTTTAAAATTCCTTACCATTAGAGGGATGCATCAAATAACAGAGGTGACTGAAGAGTTCTATGGAGTC


Protein sequences

Name Description Sequence
disease resistance protein R3a-like protein disease resistance protein R3a-like protein [Solanum demissum].

DLLNMFKRDKRDVRLLKKLRMTLLGLQAVLCDAENKKASNPYVSQWLNELQDAVDGAENLIEEVNYEVLRLKVEGQNQNLGETSNQQVSDCNLCLSDDFFINIKEKLEDTIETLEELEKQIGRLDLTKYLDSGKQETRESSTSVVDESDILGRKNEIEELVDRLLSEDGKNLTVVPVVGMGGVGKTTLAKAVYNDEKVKNHFGLKAWICVSEPYDILRITKELLQEFGSTVDNNLNQLQVKLKESLKGKKFLIVLDDIWNENYKEWDALRNLFVQGDVGSKIIVTTRKESVALMMGCGPINVGTLSSKVSWDLFKRHSFENRDPEEHPELEEVGIQIAHKCKGLPLALKALAGILRSKSEVDEWRDILRSEIWELQSRSNGILPALMLSYNDLPPQLKRCFAFCAIYPKDYLFCKEQVIHLWIANGLVQQLHSANHYFLELRSRSLFEKVRESSEWNPGEFLMHDLVNDLAQIVSSNLCMRLEDIDASHMLERTRHLSYSMGDGNFGKLKTLNKLEQLRTLLPINIQRRPFHLNKRMLHDIFPRLISLRALSLSHYENDELPNDLFIKLKHLRFLDLSWTNIKKLPDSICVLYNLETLLLSRCVFLKELPLHMEKLINLRHLDISKAKLKTPLHLSKLKSLHLLVGAKFLLGGHGGSRIEHLGELHNLYGSLLILELQHVVDRRESPKANMRKKEHVERLSLKWSRSFADNSQTENDILDELQPNANIKEIKIAGYRGTKFPNWLADHSFHKLIEVSLSYCKDCDSLPALGQLPCLKFLTIRGMHQITEVTEEFYGV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
15-795 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LLKKLRMTLLGLQAVLCDAENKKASNPYVSQWLNELQDAVDGAENLIEEVNYEVLRLKVEGQNQNLGETSNQQVSDCNLCLSDDFFINIKEKLEDTIETLEELEKQIGRLDLTKYLDSGKQETRESSTSVVDESDILGRKNEIEELVDRLLSEDGKNLTVVPVVGMGGVGKTTLAKAVYNDEKVKNHFGLKAWICVSEPYDILRITKELLQEFGSTVDNNLNQLQVKLKESLKGKKFLIVLDDIWNENYKEWDALRNLFVQGDVGSKIIVTTRKESVALMMGCGPINVGTLSSKVSWDLFKRHSFENRDPEEHPELEEVGIQIAHKCKGLPLALKALAGILRSKSEVDEWRDILRSEIWELQSRSNGILPALMLSYNDLPPQLKRCFAFCAIYPKDYLFCKEQVIHLWIANGLVQQLHSANHYFLELRSRSLFEKVRESSEWNPGEFLMHDLVNDLAQIVSSNLCMRLEDIDASHMLERTRHLSYSMGDGNFGKLKTLNKLEQLRTLLPINIQRRPFHLNKRMLHDIFPRLISLRALSLSHYENDELPNDLFIKLKHLRFLDLSWTNIKKLPDSICVLYNLETLLLSRCVFLKELPLHMEKLINLRHLDISKAKLKTPLHLSKLKSLHLLVGAKFLLGGHGGSRIEHLGELHNLYGSLLILELQHVVDRRESPKANMRKKEHVERLSLKWSRSFADNSQTENDILDELQPNANIKEIKIAGYRGTKFPNWLADHSFHKLIEVSLSYCKDCDSLPALGQLPCLKFLTIRGMHQITEVTEEFY

HMMPanther: PTHR23155:SF236
15-795 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

LLKKLRMTLLGLQAVLCDAENKKASNPYVSQWLNELQDAVDGAENLIEEVNYEVLRLKVEGQNQNLGETSNQQVSDCNLCLSDDFFINIKEKLEDTIETLEELEKQIGRLDLTKYLDSGKQETRESSTSVVDESDILGRKNEIEELVDRLLSEDGKNLTVVPVVGMGGVGKTTLAKAVYNDEKVKNHFGLKAWICVSEPYDILRITKELLQEFGSTVDNNLNQLQVKLKESLKGKKFLIVLDDIWNENYKEWDALRNLFVQGDVGSKIIVTTRKESVALMMGCGPINVGTLSSKVSWDLFKRHSFENRDPEEHPELEEVGIQIAHKCKGLPLALKALAGILRSKSEVDEWRDILRSEIWELQSRSNGILPALMLSYNDLPPQLKRCFAFCAIYPKDYLFCKEQVIHLWIANGLVQQLHSANHYFLELRSRSLFEKVRESSEWNPGEFLMHDLVNDLAQIVSSNLCMRLEDIDASHMLERTRHLSYSMGDGNFGKLKTLNKLEQLRTLLPINIQRRPFHLNKRMLHDIFPRLISLRALSLSHYENDELPNDLFIKLKHLRFLDLSWTNIKKLPDSICVLYNLETLLLSRCVFLKELPLHMEKLINLRHLDISKAKLKTPLHLSKLKSLHLLVGAKFLLGGHGGSRIEHLGELHNLYGSLLILELQHVVDRRESPKANMRKKEHVERLSLKWSRSFADNSQTENDILDELQPNANIKEIKIAGYRGTKFPNWLADHSFHKLIEVSLSYCKDCDSLPALGQLPCLKFLTIRGMHQITEVTEEFY

superfamily: SSF52540
133-378 SSF52540

GKQETRESSTSVVDESDILGRKNEIEELVDRLLSEDGKNLTVVPVVGMGGVGKTTLAKAVYNDEKVKNHFGLKAWICVSEPYDILRITKELLQEFGSTVDNNLNQLQVKLKESLKGKKFLIVLDDIWNENYKEWDALRNLFVQGDVGSKIIVTTRKESVALMMGCGPINVGTLSSKVSWDLFKRHSFENRDPEEHPELEEVGIQIAHKCKGLPLALKALAGILRSKSEVDEWRDILRSEIWELQSR

Gene3D: G3DSA:3.40.50.300
145-286 G3DSA:3.40.50.300

VDESDILGRKNEIEELVDRLLSEDGKNLTVVPVVGMGGVGKTTLAKAVYNDEKVKNHFGLKAWICVSEPYDILRITKELLQEFGSTVDNNLNQLQVKLKESLKGKKFLIVLDDIWNENYKEWDALRNLFVQGDVGSKIIVTT

HMMPfam: PF00931
IPR002182
153-431 NB-ARC,NBS
NB-ARC

RKNEIEELVDRLLSEDGKNLTVVPVVGMGGVGKTTLAKAVYNDEKVKNHFGLKAWICVSEPYDILRITKELLQEFGSTVDNNLNQLQVKLKESLKGKKFLIVLDDIWNENYKEWDALRNLFVQGDVGSKIIVTTRKESVALMMGCGPINVGTLSSKVSWDLFKRHSFENRDPEEHPELEEVGIQIAHKCKGLPLALKALAGILRSKSEVDEWRDILRSEIWELQSRSNGILPALMLSYNDLPPQLKRCFAFCAIYPKDYLFCKEQVIHLWIANGLVQQL

FPrintScan: PR00364
IPR000767
174-189 DISEASERSIST
Disease resistance protein

VVPVVGMGGVGKTTLA

FPrintScan: PR00364
IPR000767
245-259 DISEASERSIST
Disease resistance protein

SLKGKKFLIVLDDIW

FPrintScan: PR00364
IPR000767
341-355 DISEASERSIST
Disease resistance protein

CKGLPLALKALAGIL

superfamily: SSF52058
462-796 SSF52058,LRR

LMHDLVNDLAQIVSSNLCMRLEDIDASHMLERTRHLSYSMGDGNFGKLKTLNKLEQLRTLLPINIQRRPFHLNKRMLHDIFPRLISLRALSLSHYENDELPNDLFIKLKHLRFLDLSWTNIKKLPDSICVLYNLETLLLSRCVFLKELPLHMEKLINLRHLDISKAKLKTPLHLSKLKSLHLLVGAKFLLGGHGGSRIEHLGELHNLYGSLLILELQHVVDRRESPKANMRKKEHVERLSLKWSRSFADNSQTENDILDELQPNANIKEIKIAGYRGTKFPNWLADHSFHKLIEVSLSYCKDCDSLPALGQLPCLKFLTIRGMHQITEVTEEFYG

Gene3D: G3DSA:3.80.10.10
522-665 G3DSA:3.80.10.10

LPINIQRRPFHLNKRMLHDIFPRLISLRALSLSHYENDELPNDLFIKLKHLRFLDLSWTNIKKLPDSICVLYNLETLLLSRCVFLKELPLHMEKLINLRHLDISKAKLKTPLHLSKLKSLHLLVGAKFLLGGHGGSRIEHLGEL

FPrintScan: PR00364
IPR000767
567-583 DISEASERSIST
Disease resistance protein

IKLKHLRFLDLSWTNIK

Gene3D: G3DSA:3.80.10.10
728-790 G3DSA:3.80.10.10

IKEIKIAGYRGTKFPNWLADHSFHKLIEVSLSYCKDCDSLPALGQLPCLKFLTIRGMHQITEV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox