PRGDB00047257 (disease resistance protein R3a-like protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein R3a-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 157280344 (EF613528)
Gene Class NL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, Others
Gene Species Solanum demissum

Comment?

Solanum demissum isolate 26N3 disease resistance protein R3a-like protein gene, partial cds.

DNA Sequence

TTGGGTGGTGCATTTCTCTCTTCAGCTTTGAATGTTCTCTTTGATAGGCTTGCTCCTCAGGGTGATCTGCTCAACATGTTTCAGAAGCATAAGCATCATGTTCGGCTCTTAAAGAAGCTGAAAATGACTTTGCGTGGTCTTCAGATTGTGCTAAGTGATGCAGAGAATAAGCAAGCATCAAATCCATCTGTGCGTGACTGGCTTAATGAGCTTCGAGATGCTGTCGACTCTGCTGAAAACTTTATAGAAGAAGTCAATTATGAAGCTTTGAGGCTTAAGGTGGAAGGTCAGAATCTTGCAGAAACAAGCAACCAGCTAGTAAGTGACCTCAACCTTTGCTTGAGTGATGAATTTTTACTTAACATAGAGGACAAGTTGGAAGACACTATTGAAACATTAAAGGATTTGCAAGAGCAAATTGGTCTCCTTGGCTTAAAGGAGTATTTTGGTTCCACGAAACTAGAAACTAGAAGACCTTCAACTTCTGTGGATGATGAATCTGATATCTTTGGTAGACTGAGCGAAATAGAGGATTTGATTGACCGTTTATTGTCTGAAGATGCAAGTGGGAAAAAGCTGACAGTAGTTCCTATTGTTGGAATGGGCGGCCTGGGTAAGACAACACTTGCTAAAGCCGTATACAATGATGAGAGGGTGAAGAACCATTTTGGTTTGAAAGCTTGGTATTGTGTTTCTGAGCCATATGATGCTTTGAGAATAACAAAAGGGTTACTTCAAGAAATTGGCAAATTTGACTCAWAGGATGTCCACAACAATCTTAATCAGCTTCAAGTCAAATTGAAGGAAAGCTTGAAGGAAAAGAAGTTCCTTATTGTTTTGGATGATGTGTGGAATGACAACTACAACGAGTGGGATGACTTGAGAAATATTTTTGTACAAGGAGAAATAGGAAGCAAGATCATTGTGACGACACGCAAAGAGAGTGCTGCCTTGATGATGGGAAATGAGAAAATTAGCATGGACAATTTGTCTACTGAAGCCTCTTGGTCTTTATTTAAAAGACATGCATTTGAAAACATGGATCCTATGGGACATCCGGAACTTGAAGAGGTCGGTAAACAAATTGCAGCTAAGTGCAAAGGACTGCCCTTAGCTCTGAAGACGCTCGCTGGCATGTTACGCTCCAAATCAGAGGTTGAAGAGTGGAAACGTATTTTGAGAAGTGAAATGTGGGAGCTGCGAGACAATGATATATTACCAGCGCTGATGTTGAGCTACAATGATCTTCCCGCACATTTAAAGCGATGTTTTTCCTTTTGTGCAATATTTCCTAAAGATTATCCATTTAGGAAAGAACAAGTTATTCATCTGTGGATTGCTAATGATATCGTACCACAGGAAGATGAGATAATTCAAGATTCAGGCAACCAGTACTTTCTCGAATTGAGATCAAGATCATTATTCGAAAAGGTCCCAAATCCTTCTAAAAGGAACATAGAGGAATTATTCTTAATGCATGACCTTGTCAATGATTTAGCCCAAATTGCATCTTCAAAACTTTGTATCAGGTTGGAAGAGAGCAAAGGATCTGATATGTTGGAAAAAAGTCGGCACTTATCTTATTCAATGGGAGAAGATGGTGAGTTTGAGAAATTGACACCTCTCTACAAATTGGAGCAGCTGAGGACATTGTTTCCGACATGTATTGATCTCACGGATTGTTATCACCCTCTAAGCAAGAGGGTGTTGCATAACATACTGCCAAGACTAAGATCCTTGAGGGTACTATCATTGTCTCATTACGAGATTAAGGAGTTGCCAAATGACTTGTTTATCAAATTAAAGCTCCTCAGATTTTTGGACCTTTCTTGTACAGAGATTAAAAAGTTGCCAGATTCCATATGTGCATTGTATAACTTGGAAACACTTATCCTGTCATCTTGTGTTAATCTTGAGGAGCTACCGCTGCAGATGGAGAAGTTGATTAACTTGCATCATCTTGACATAAGCAACACTTGTCGCTTGAAGATGCCACTACATCTGAGCAAGTTGAAAAGCCTCCAAGTGCTAGTGGGAGTAAAGTTTCTTCTAGGTGGTTGGAGGATGGAAGATTTGGGTGAAGCACAGAACTTGTATGGATCTCTATCAGTTTTAGAGTTGCAAAATGTGGTTGATAGAAGGGAAGCTGTGAAGGCAAAGATGAGGGAGAAGAATCATGCTGAGCAGTTATCTTTGGAGTGGAGTGAAAGTAGTAGTGCCGACAATTCAAAAACTGAAAGAGACATTCTTGATGAGCTACGCCCACATAAAAACATAAAAGAAGTCGAAATCACCGGATATAGAGGGACAATATTTCCGAATTGGCTAGCTGATCCTTTGTTTCTTAAGCTAGAACAGCTGTCTATTGATAACTGTAAGAACTGTTTTTCCTTGCCAGCACTAGGACAGCTTCCTTGTTTGAAAATCCTTTCCATTAGAGGGATGCATGGAATAACAGAGGTGACGGAAGAATTCTATGGTTGTTTGTCGTCCAAAAAGCCWTTTAACTGTCTTGAGAAGCTTGTATTTGAAGATATGGCGGAGTGGAAGAAATGGCACGTACTAGGAAGTGGAGAGTTCCCTATACTTGAGAACCTTTTAATTAAAAATTGCCCTGAACTCAGTTTGGAGACACCCATGCAACTTTCATGTTTAAAAAGGTTTAAAGTTGTTGGTTCTTCTAAGGTTGGAGTTGTTTTTGATGATGCTCAACTGTTAAAATCCCAACTTGAGGGAACGAAGGAGATTGAGGAATTAGATATTAGGGACTGTAACTCTCTTACCTCCTTTCCTTTTAGCATACTGCCCACTACCTTGAAGACAATAAGGATATCTGGTTGCCAGAAATTGAAATTGGATCCGCCAGTTGGTGAGATGAGTATGTTTCTCGAGGAACTGAATGTGGAAAAATGTGATTGTATAGATGATATATCAGTTGTAGAGTTGCTCCCAAGAGCACGCATATTGGATGTATCTGATTTCCAGAACCTTACTAGGTTTTTGATTCCTACTGTCACTGAAAGTCTCTCTATTTGGTATTGTGCGAATGTTGAAAAACTATCGGTGGCATGGGGGACCCAGATGACGTTTTTGCATATTTGGGACTGTAATAAGTTGAAGTGGCTGCCAGAACGTATGCAGGAACTCCTTCCATCTCTTAATACACTGCATCTGTTTGGATGTCCAGAAATAGAGTCCTTTCCTGAAGGAGGATTGCCCTTCAATTTACAAATACTTGTGATCGTCAATTGCAACAAACTGGTGAATGGCCGAAAGGAGTGGCGTTTACAGAGACTCCCCTGTCTCACAGAGTTATTAATTACACATGATGGCAGTGACGAAGAGATTGTTGGTGGTGAGAATTGGGAGTTTCCTTCCTCTATTCAAACACTTAGCATACGGAATCTGANAACATTAAGCAGCCAACATCTCAAAAGCCTCACCTCTCTTCAATCTCTATATATTAAGGGTAATTTACCTCAAATTCAGTCAATGCTGGAACAAGGCCAGTTTTTTTCCTCCTTTCTGCATCTCACTTCGCTTCAAAGTCTACACATCGAGGATATCCCTAATCTC


Protein sequences

Name Description Sequence
disease resistance protein R3a-like protein disease resistance protein R3a-like protein [Solanum demissum].

LGGAFLSSALNVLFDRLAPQGDLLNMFQKHKHHVRLLKKLKMTLRGLQIVLSDAENKQASNPSVRDWLNELRDAVDSAENFIEEVNYEALRLKVEGQNLAETSNQLVSDLNLCLSDEFLLNIEDKLEDTIETLKDLQEQIGLLGLKEYFGSTKLETRRPSTSVDDESDIFGRLSEIEDLIDRLLSEDASGKKLTVVPIVGMGGLGKTTLAKAVYNDERVKNHFGLKAWYCVSEPYDALRITKGLLQEIGKFDSXDVHNNLNQLQVKLKESLKEKKFLIVLDDVWNDNYNEWDDLRNIFVQGEIGSKIIVTTRKESAALMMGNEKISMDNLSTEASWSLFKRHAFENMDPMGHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEMWELRDNDILPALMLSYNDLPAHLKRCFSFCAIFPKDYPFRKEQVIHLWIANDIVPQEDEIIQDSGNQYFLELRSRSLFEKVPNPSKRNIEELFLMHDLVNDLAQIASSKLCIRLEESKGSDMLEKSRHLSYSMGEDGEFEKLTPLYKLEQLRTLFPTCIDLTDCYHPLSKRVLHNILPRLRSLRVLSLSHYEIKELPNDLFIKLKLLRFLDLSCTEIKKLPDSICALYNLETLILSSCVNLEELPLQMEKLINLHHLDISNTCRLKMPLHLSKLKSLQVLVGVKFLLGGWRMEDLGEAQNLYGSLSVLELQNVVDRREAVKAKMREKNHAEQLSLEWSESSSADNSKTERDILDELRPHKNIKEVEITGYRGTIFPNWLADPLFLKLEQLSIDNCKNCFSLPALGQLPCLKILSIRGMHGITEVTEEFYGCLSSKKPFNCLEKLVFEDMAEWKKWHVLGSGEFPILENLLIKNCPELSLETPMQLSCLKRFKVVGSSKVGVVFDDAQLLKSQLEGTKEIEELDIRDCNSLTSFPFSILPTTLKTIRISGCQKLKLDPPVGEMSMFLEELNVEKCDCIDDISVVELLPRARILDVSDFQNLTRFLIPTVTESLSIWYCANVEKLSVAWGTQMTFLHIWDCNKLKWLPERMQELLPSLNTLHLFGCPEIESFPEGGLPFNLQILVIVNCNKLVNGRKEWRLQRLPCLTELLITHDGSDEEIVGGENWEFPSSIQTLSIRNLXTLSSQHLKSLTSLQSLYIKGNLPQIQSMLEQGQFFSSFLHLTSLQSLHIEDIPNL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF236
8-874 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

SALNVLFDRLAPQGDLLNMFQKHKHHVRLLKKLKMTLRGLQIVLSDAENKQASNPSVRDWLNELRDAVDSAENFIEEVNYEALRLKVEGQNLAETSNQLVSDLNLCLSDEFLLNIEDKLEDTIETLKDLQEQIGLLGLKEYFGSTKLETRRPSTSVDDESDIFGRLSEIEDLIDRLLSEDASGKKLTVVPIVGMGGLGKTTLAKAVYNDERVKNHFGLKAWYCVSEPYDALRITKGLLQEIGKFDSXDVHNNLNQLQVKLKESLKEKKFLIVLDDVWNDNYNEWDDLRNIFVQGEIGSKIIVTTRKESAALMMGNEKISMDNLSTEASWSLFKRHAFENMDPMGHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEMWELRDNDILPALMLSYNDLPAHLKRCFSFCAIFPKDYPFRKEQVIHLWIANDIVPQEDEIIQDSGNQYFLELRSRSLFEKVPNPSKRNIEELFLMHDLVNDLAQIASSKLCIRLEESKGSDMLEKSRHLSYSMGEDGEFEKLTPLYKLEQLRTLFPTCIDLTDCYHPLSKRVLHNILPRLRSLRVLSLSHYEIKELPNDLFIKLKLLRFLDLSCTEIKKLPDSICALYNLETLILSSCVNLEELPLQMEKLINLHHLDISNTCRLKMPLHLSKLKSLQVLVGVKFLLGGWRMEDLGEAQNLYGSLSVLELQNVVDRREAVKAKMREKNHAEQLSLEWSESSSADNSKTERDILDELRPHKNIKEVEITGYRGTIFPNWLADPLFLKLEQLSIDNCKNCFSLPALGQLPCLKILSIRGMHGITEVTEEFYGCLSSKKPFNCLEKLVFEDMAEWKKWHVLGSGEFPILENLLIKNCPEL

HMMPanther: PTHR23155
8-874 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SALNVLFDRLAPQGDLLNMFQKHKHHVRLLKKLKMTLRGLQIVLSDAENKQASNPSVRDWLNELRDAVDSAENFIEEVNYEALRLKVEGQNLAETSNQLVSDLNLCLSDEFLLNIEDKLEDTIETLKDLQEQIGLLGLKEYFGSTKLETRRPSTSVDDESDIFGRLSEIEDLIDRLLSEDASGKKLTVVPIVGMGGLGKTTLAKAVYNDERVKNHFGLKAWYCVSEPYDALRITKGLLQEIGKFDSXDVHNNLNQLQVKLKESLKEKKFLIVLDDVWNDNYNEWDDLRNIFVQGEIGSKIIVTTRKESAALMMGNEKISMDNLSTEASWSLFKRHAFENMDPMGHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEMWELRDNDILPALMLSYNDLPAHLKRCFSFCAIFPKDYPFRKEQVIHLWIANDIVPQEDEIIQDSGNQYFLELRSRSLFEKVPNPSKRNIEELFLMHDLVNDLAQIASSKLCIRLEESKGSDMLEKSRHLSYSMGEDGEFEKLTPLYKLEQLRTLFPTCIDLTDCYHPLSKRVLHNILPRLRSLRVLSLSHYEIKELPNDLFIKLKLLRFLDLSCTEIKKLPDSICALYNLETLILSSCVNLEELPLQMEKLINLHHLDISNTCRLKMPLHLSKLKSLQVLVGVKFLLGGWRMEDLGEAQNLYGSLSVLELQNVVDRREAVKAKMREKNHAEQLSLEWSESSSADNSKTERDILDELRPHKNIKEVEITGYRGTIFPNWLADPLFLKLEQLSIDNCKNCFSLPALGQLPCLKILSIRGMHGITEVTEEFYGCLSSKKPFNCLEKLVFEDMAEWKKWHVLGSGEFPILENLLIKNCPEL

superfamily: SSF52540
152-403 SSF52540

TKLETRRPSTSVDDESDIFGRLSEIEDLIDRLLSEDASGKKLTVVPIVGMGGLGKTTLAKAVYNDERVKNHFGLKAWYCVSEPYDALRITKGLLQEIGKFDSXDVHNNLNQLQVKLKESLKEKKFLIVLDDVWNDNYNEWDDLRNIFVQGEIGSKIIVTTRKESAALMMGNEKISMDNLSTEASWSLFKRHAFENMDPMGHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEMWELRDN

Gene3D: G3DSA:3.40.50.300
166-299 G3DSA:3.40.50.300

ESDIFGRLSEIEDLIDRLLSEDASGKKLTVVPIVGMGGLGKTTLAKAVYNDERVKNHFGLKAWYCVSEPYDALRITKGLLQEIGKFDSXDVHNNLNQLQVKLKESLKEKKFLIVLDDVWNDNYNEWDDLRNIFV

HMMPfam: PF00931
IPR002182
174-455 NB-ARC,NBS
NB-ARC

SEIEDLIDRLLSEDASGKKLTVVPIVGMGGLGKTTLAKAVYNDERVKNHFGLKAWYCVSEPYDALRITKGLLQEIGKFDSXDVHNNLNQLQVKLKESLKEKKFLIVLDDVWNDNYNEWDDLRNIFVQGEIGSKIIVTTRKESAALMMGNEKISMDNLSTEASWSLFKRHAFENMDPMGHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEMWELRDNDILPALMLSYNDLPAHLKRCFSFCAIFPKDYPFRKEQVIHLWIANDIVPQED

FPrintScan: PR00364
IPR000767
195-210 DISEASERSIST
Disease resistance protein

VVPIVGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
270-284 DISEASERSIST
Disease resistance protein

SLKEKKFLIVLDDVW

FPrintScan: PR00364
IPR000767
366-380 DISEASERSIST
Disease resistance protein

CKGLPLALKTLAGML

superfamily: SSF52058
491-995 SSF52058,LRR

LMHDLVNDLAQIASSKLCIRLEESKGSDMLEKSRHLSYSMGEDGEFEKLTPLYKLEQLRTLFPTCIDLTDCYHPLSKRVLHNILPRLRSLRVLSLSHYEIKELPNDLFIKLKLLRFLDLSCTEIKKLPDSICALYNLETLILSSCVNLEELPLQMEKLINLHHLDISNTCRLKMPLHLSKLKSLQVLVGVKFLLGGWRMEDLGEAQNLYGSLSVLELQNVVDRREAVKAKMREKNHAEQLSLEWSESSSADNSKTERDILDELRPHKNIKEVEITGYRGTIFPNWLADPLFLKLEQLSIDNCKNCFSLPALGQLPCLKILSIRGMHGITEVTEEFYGCLSSKKPFNCLEKLVFEDMAEWKKWHVLGSGEFPILENLLIKNCPELSLETPMQLSCLKRFKVVGSSKVGVVFDDAQLLKSQLEGTKEIEELDIRDCNSLTSFPFSILPTTLKTIRISGCQKLKLDPPVGEMSMFLEELNVEKCDCIDDISVVELLPRARILDVSDFQ

Gene3D: G3DSA:3.80.10.10
570-677 G3DSA:3.80.10.10

LHNILPRLRSLRVLSLSHYEIKELPNDLFIKLKLLRFLDLSCTEIKKLPDSICALYNLETLILSSCVNLEELPLQMEKLINLHHLDISNTCRLKMPLHLSKLKSLQVL

FPrintScan: PR00364
IPR000767
622-638 DISEASERSIST
Disease resistance protein

CALYNLETLILSSCVNL

Gene3D: G3DSA:3.80.10.10
742-888 G3DSA:3.80.10.10

NSKTERDILDELRPHKNIKEVEITGYRGTIFPNWLADPLFLKLEQLSIDNCKNCFSLPALGQLPCLKILSIRGMHGITEVTEEFYGCLSSKKPFNCLEKLVFEDMAEWKKWHVLGSGEFPILENLLIKNCPELSLETPMQLSCLKRF

Gene3D: G3DSA:3.80.10.10
904-1050 G3DSA:3.80.10.10

QLLKSQLEGTKEIEELDIRDCNSLTSFPFSILPTTLKTIRISGCQKLKLDPPVGEMSMFLEELNVEKCDCIDDISVVELLPRARILDVSDFQNLTRFLIPTVTESLSIWYCANVEKLSVAWGTQMTFLHIWDCNKLKWLPERMQELL

superfamily: SSF52058
905-1190 SSF52058,LRR

LLKSQLEGTKEIEELDIRDCNSLTSFPFSILPTTLKTIRISGCQKLKLDPPVGEMSMFLEELNVEKCDCIDDISVVELLPRARILDVSDFQNLTRFLIPTVTESLSIWYCANVEKLSVAWGTQMTFLHIWDCNKLKWLPERMQELLPSLNTLHLFGCPEIESFPEGGLPFNLQILVIVNCNKLVNGRKEWRLQRLPCLTELLITHDGSDEEIVGGENWEFPSSIQTLSIRNLXTLSSQHLKSLTSLQSLYIKGNLPQIQSMLEQGQFFSSFLHLTSLQSLHIEDIP

Gene3D: G3DSA:3.80.10.10
1051-1188 G3DSA:3.80.10.10

PSLNTLHLFGCPEIESFPEGGLPFNLQILVIVNCNKLVNGRKEWRLQRLPCLTELLITHDGSDEEIVGGENWEFPSSIQTLSIRNLXTLSSQHLKSLTSLQSLYIKGNLPQIQSMLEQGQFFSSFLHLTSLQSLHIED






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox