PRGDB00047258 (disease resistance protein R3a-like protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein R3a-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 157280341 (EF613526)
Gene Class NL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, Others
Gene Species Solanum demissum

Comment?

Solanum demissum isolate 184J15 disease resistance protein R3a-like protein gene, partial cds.

DNA Sequence

AGTTGGTGGTGCATTTCTCTCTTCAGCTTTGAATGTTCTCTTTGATAGGCTTGCTCCTCACGGTGATCTCCTCAACATGTTTCGGAAGCATAAGGATCATGTTCAGCTCTTACACAAGCTGGAGGACATTTTGCTTGGTCTTCAGATTGTGCTAAGTGATGCAGAGAATAAGCAAGCATCAAATCGACACGTGAGCCAGTGGTTCAATAAGCTTCAGAATGCTGTGGACGGCGCTGAAAACTTGATAGAAGAAGTCAATTATGAAGCTTTGAGGCTTAAGGTGGAAGGCCAGCATCAAAATCTTGCAGAAACAAGCAACAAACAAGTAAGTGACCTCAACCTGTGCTTGACTGATGAATTTTTCCTTAACATAAAGGAGAAGTTGGAAGAAACCATTGAAACATTGGAGGTGTTGGAAAAGCAAATTGGTCGCCTTGGCTTAAAGGAGCATTTTGGTTCGACTAAACAAGAAACTAGAACACCTTCAACTTCTTTGGTTGATGATGATGGTATCTTTGGAAGGCAGAATGATATAGAGGATTTGATTGACCGTTTATTATCTGAAGATGCAAGTGGAAAAAAGCTGACTGTAGTTCCTATTGTTGGAATGGGCGGCCTGGGTAAGACAACACTTGCTAAAGCTGTTTACAATGATGAGAGAGTGCAGAAACATTTTGTTTTGAAAGCTTGGTTTTGTGTTTCCGAGGCATATGATGCTTTCAGAATAACAAAAGGGTTACTTCAAGAAATTGGCTCAACTGACTTGAAGGTTGATGACAATCTTAACCAGCTACAAGTCAAATTGAAGGAAGGATTAAAGGGAAAGAAGTTTCTTCTTGTTCTGGACGATGTGTGGAATGACAACTACAACGAGTGGGATGACTTGAAAAATGTTTTTGTACAAGGAGATATAGGAAGTAAGATCATTGTGACGACACGTAAAGAGAGTGTTGCCTTGATAATGGGAAATGAGCAAATTAGCATGGACAATTTGTCTACTGAAGCCTCTTGGTCTTTATTTAAAAGACATGCATTTGAAAACATGGATCCTATGGGACATCCGGAACTTGAAGAGGTCGGAAAACAAATTGCAGCTAAGTGCAAAGGACTGCCCTTAGCTCTGAAGACGCTCGCTGGCATGTTACGCTCCAAATCAGAGGTTGAAGAGTGGAAACATATTTTGAGAAGTGAAATATGGGAGCTGCCACACAATGACGTATTACCAGCGTTGATGTTGAGCTACAATGATCTTCCTGCACATTTAAAGCGATGTTTTTCCTATTGTGCAATATTTCCTAAAGATTATCCATTTAGGAAAGAACAAGTCATTCATCTGTGGATTGCCAATGGTCTCATACCTCAGGAAGATGAAAGAATTGAAGATTCAGGCAACCAATACTTTCTCGAGTTGAGGTCAAGATCATTATTCGAAAGGGTCCCAAATCCTTCTGAAGGGAACATAGAGAATTTATTCTTAATGCATGACCTTGTCAATGATTTAGCCCAAATTGCATCTTCAAAACTTTGTATTAGGTTGGAAGAGAGCAAAGGATCTCATATGTTGGAAAAAAGTCGGCACTTATCTTATTCAATGGGATATGGTGAGTTTGAGAAATTGACACCCCTCTACAAATTGGAGCAGCTGAGGACATTGCTTCCGACATGTATTAGTGTCAATAATTGTTATCACCGTCTAAGCAAGAGGGTGCAGCTTAACATACTGCCTAGACTAAGATCCTTGAGGGTACTATCATTGTCTCATTACATGATTATGGAGTTGCCAAATGACTTGTTTATCAAATTAAAACTCCTCAGATTTTTGGACCTTTCTGAGACAGGGATTACAAAGTTGCCAGATTCCATTTGTGCATTGTATAACTTAGAGACACTTCTCTTGTCATCTTGTATTTATCTTAAGGAGCTACCGCTGCAGATGGAGAAGTTGATTAACTTGCGTCATCTTGACATAAGCAACACTTCTCACTTGAAGATTCCACTACATCTGAGCAAGTTGAAAAGCCTCCAAGTGCTAGTGGGAGCCAAGTTTCTTCTAAGTGGTTGGAGAATGGAAGATTTGGGTGAAGCACAGAACTTGTATGGATCTCTATCAGTTGTAGAGTTGCAAAATGTGGTTGATAGAAGGGAAGCTGTGAAGGCAAAGATGAGGGAGAAGAATCATGTTGACAAGTTATCGCTGGAGTGGAGTGAAAGTAGTAGTGCCGACAATTCACAAACAGAAAGAGACATACTTGATGAGTTACGCCCACATAAAAACATAAAAGAAGTCGAAATCACTGGATATAGAGGGACAATATTTCCAAATTGGCTAGCTGATCCTTTGTTTCTTAAGCTGGTGAAATTGTCTCTTAGCTACTGCACGGACTGTTATTCCTTGCCAGCACTAGGACAACTCCCTTCTTTGAAAATCCTTTCCGTTAAAGGGATGCATGGAATAACAGAGGTGAGGGAAGAATTCTATGGCAGTCTGTCCTCCAAAAAGCCTTTTAACTGTCTTGAGAAGCTTGAATTTGAAGATATGGCGGAGTGGAAGCAATGGCACGTACTAGGAATTGGAGAGTTCCCTACACTTGAGAGGCTTTTAATTAAAAATTGCCCTGAAGTCAGTTTGGAGACACCCATCCAACTTTCAAGTTTAAAAAGGTTTGAGGTTAGTGGTTCTCCAAAGGTTGGAGTTGTTTTTGATGATGCTCAACTGTTTAGATCCCAACTTGAGGGAATGAAGCAGATTGAGGAATTATTTATTAGGAATTGTAACTCTGTTACCTCCTTTCCTTTTAGCATACTGCCCACTACCTTGAAGAGAATAGAGATATCTGGTTGCAAGAAATTGAAATTGGAAGCGATGAGTTATTGTAACATGTTTCTGAAGTATTGTATATCACCTGAGTTACTCCCAAGAGCACGCTCTTTGAGGGTAGAGTATTGCCAGAACTTTACTAAGTTTTTGATTCCTACTGCCACTGAAAGTCTCTGTATTTGGAATTGTGGGTATGTTGAAAAACTTTCGGTGGCATGTGGGGGGAGCCAGATGACGTCACTGAGTATTTGGGGCTGTAGGAAGCTGAAGTGGCTGCCAGAACGTATGCAGGAACTCCTTCCATCTCTTAATACACTGCATCTGGTTTTTTGTCCAGAAATAGAGTCCTTTCCTGAAGGAGGATTGCCCTTCAATTTACAAGTCCTTCAGATCAGCGGGTGCAAGAAACTGGTGAATGT


Protein sequences

Name Description Sequence
disease resistance protein R3a-like protein disease resistance protein R3a-like protein [Solanum demissum].

VGGAFLSSALNVLFDRLAPHGDLLNMFRKHKDHVQLLHKLEDILLGLQIVLSDAENKQASNRHVSQWFNKLQNAVDGAENLIEEVNYEALRLKVEGQHQNLAETSNKQVSDLNLCLTDEFFLNIKEKLEETIETLEVLEKQIGRLGLKEHFGSTKQETRTPSTSLVDDDGIFGRQNDIEDLIDRLLSEDASGKKLTVVPIVGMGGLGKTTLAKAVYNDERVQKHFVLKAWFCVSEAYDAFRITKGLLQEIGSTDLKVDDNLNQLQVKLKEGLKGKKFLLVLDDVWNDNYNEWDDLKNVFVQGDIGSKIIVTTRKESVALIMGNEQISMDNLSTEASWSLFKRHAFENMDPMGHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEEWKHILRSEIWELPHNDVLPALMLSYNDLPAHLKRCFSYCAIFPKDYPFRKEQVIHLWIANGLIPQEDERIEDSGNQYFLELRSRSLFERVPNPSEGNIENLFLMHDLVNDLAQIASSKLCIRLEESKGSHMLEKSRHLSYSMGYGEFEKLTPLYKLEQLRTLLPTCISVNNCYHRLSKRVQLNILPRLRSLRVLSLSHYMIMELPNDLFIKLKLLRFLDLSETGITKLPDSICALYNLETLLLSSCIYLKELPLQMEKLINLRHLDISNTSHLKIPLHLSKLKSLQVLVGAKFLLSGWRMEDLGEAQNLYGSLSVVELQNVVDRREAVKAKMREKNHVDKLSLEWSESSSADNSQTERDILDELRPHKNIKEVEITGYRGTIFPNWLADPLFLKLVKLSLSYCTDCYSLPALGQLPSLKILSVKGMHGITEVREEFYGSLSSKKPFNCLEKLEFEDMAEWKQWHVLGIGEFPTLERLLIKNCPEVSLETPIQLSSLKRFEVSGSPKVGVVFDDAQLFRSQLEGMKQIEELFIRNCNSVTSFPFSILPTTLKRIEISGCKKLKLEAMSYCNMFLKYCISPELLPRARSLRVEYCQNFTKFLIPTATESLCIWNCGYVEKLSVACGGSQMTSLSIWGCRKLKWLPERMQELLPSLNTLHLVFCPEIESFPEGGLPFNLQVLQISGCKKLVNV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
5-874 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FLSSALNVLFDRLAPHGDLLNMFRKHKDHVQLLHKLEDILLGLQIVLSDAENKQASNRHVSQWFNKLQNAVDGAENLIEEVNYEALRLKVEGQHQNLAETSNKQVSDLNLCLTDEFFLNIKEKLEETIETLEVLEKQIGRLGLKEHFGSTKQETRTPSTSLVDDDGIFGRQNDIEDLIDRLLSEDASGKKLTVVPIVGMGGLGKTTLAKAVYNDERVQKHFVLKAWFCVSEAYDAFRITKGLLQEIGSTDLKVDDNLNQLQVKLKEGLKGKKFLLVLDDVWNDNYNEWDDLKNVFVQGDIGSKIIVTTRKESVALIMGNEQISMDNLSTEASWSLFKRHAFENMDPMGHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEEWKHILRSEIWELPHNDVLPALMLSYNDLPAHLKRCFSYCAIFPKDYPFRKEQVIHLWIANGLIPQEDERIEDSGNQYFLELRSRSLFERVPNPSEGNIENLFLMHDLVNDLAQIASSKLCIRLEESKGSHMLEKSRHLSYSMGYGEFEKLTPLYKLEQLRTLLPTCISVNNCYHRLSKRVQLNILPRLRSLRVLSLSHYMIMELPNDLFIKLKLLRFLDLSETGITKLPDSICALYNLETLLLSSCIYLKELPLQMEKLINLRHLDISNTSHLKIPLHLSKLKSLQVLVGAKFLLSGWRMEDLGEAQNLYGSLSVVELQNVVDRREAVKAKMREKNHVDKLSLEWSESSSADNSQTERDILDELRPHKNIKEVEITGYRGTIFPNWLADPLFLKLVKLSLSYCTDCYSLPALGQLPSLKILSVKGMHGITEVREEFYGSLSSKKPFNCLEKLEFEDMAEWKQWHVLGIGEFPTLERLLIKNCPEV

HMMPanther: PTHR23155:SF236
5-874 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

FLSSALNVLFDRLAPHGDLLNMFRKHKDHVQLLHKLEDILLGLQIVLSDAENKQASNRHVSQWFNKLQNAVDGAENLIEEVNYEALRLKVEGQHQNLAETSNKQVSDLNLCLTDEFFLNIKEKLEETIETLEVLEKQIGRLGLKEHFGSTKQETRTPSTSLVDDDGIFGRQNDIEDLIDRLLSEDASGKKLTVVPIVGMGGLGKTTLAKAVYNDERVQKHFVLKAWFCVSEAYDAFRITKGLLQEIGSTDLKVDDNLNQLQVKLKEGLKGKKFLLVLDDVWNDNYNEWDDLKNVFVQGDIGSKIIVTTRKESVALIMGNEQISMDNLSTEASWSLFKRHAFENMDPMGHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEEWKHILRSEIWELPHNDVLPALMLSYNDLPAHLKRCFSYCAIFPKDYPFRKEQVIHLWIANGLIPQEDERIEDSGNQYFLELRSRSLFERVPNPSEGNIENLFLMHDLVNDLAQIASSKLCIRLEESKGSHMLEKSRHLSYSMGYGEFEKLTPLYKLEQLRTLLPTCISVNNCYHRLSKRVQLNILPRLRSLRVLSLSHYMIMELPNDLFIKLKLLRFLDLSETGITKLPDSICALYNLETLLLSSCIYLKELPLQMEKLINLRHLDISNTSHLKIPLHLSKLKSLQVLVGAKFLLSGWRMEDLGEAQNLYGSLSVVELQNVVDRREAVKAKMREKNHVDKLSLEWSESSSADNSQTERDILDELRPHKNIKEVEITGYRGTIFPNWLADPLFLKLVKLSLSYCTDCYSLPALGQLPSLKILSVKGMHGITEVREEFYGSLSSKKPFNCLEKLEFEDMAEWKQWHVLGIGEFPTLERLLIKNCPEV

superfamily: SSF52540
154-404 SSF52540

TKQETRTPSTSLVDDDGIFGRQNDIEDLIDRLLSEDASGKKLTVVPIVGMGGLGKTTLAKAVYNDERVQKHFVLKAWFCVSEAYDAFRITKGLLQEIGSTDLKVDDNLNQLQVKLKEGLKGKKFLLVLDDVWNDNYNEWDDLKNVFVQGDIGSKIIVTTRKESVALIMGNEQISMDNLSTEASWSLFKRHAFENMDPMGHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEEWKHILRSEIWELPHN

Gene3D: G3DSA:3.40.50.300
173-315 G3DSA:3.40.50.300

GRQNDIEDLIDRLLSEDASGKKLTVVPIVGMGGLGKTTLAKAVYNDERVQKHFVLKAWFCVSEAYDAFRITKGLLQEIGSTDLKVDDNLNQLQVKLKEGLKGKKFLLVLDDVWNDNYNEWDDLKNVFVQGDIGSKIIVTTRKE

HMMPfam: PF00931
IPR002182
174-456 NB-ARC,NBS
NB-ARC

RQNDIEDLIDRLLSEDASGKKLTVVPIVGMGGLGKTTLAKAVYNDERVQKHFVLKAWFCVSEAYDAFRITKGLLQEIGSTDLKVDDNLNQLQVKLKEGLKGKKFLLVLDDVWNDNYNEWDDLKNVFVQGDIGSKIIVTTRKESVALIMGNEQISMDNLSTEASWSLFKRHAFENMDPMGHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEEWKHILRSEIWELPHNDVLPALMLSYNDLPAHLKRCFSYCAIFPKDYPFRKEQVIHLWIANGLIPQED

FPrintScan: PR00364
IPR000767
197-212 DISEASERSIST
Disease resistance protein

VVPIVGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
271-285 DISEASERSIST
Disease resistance protein

GLKGKKFLLVLDDVW

FPrintScan: PR00364
IPR000767
367-381 DISEASERSIST
Disease resistance protein

CKGLPLALKTLAGML

superfamily: SSF52058
492-948 SSF52058,LRR

LMHDLVNDLAQIASSKLCIRLEESKGSHMLEKSRHLSYSMGYGEFEKLTPLYKLEQLRTLLPTCISVNNCYHRLSKRVQLNILPRLRSLRVLSLSHYMIMELPNDLFIKLKLLRFLDLSETGITKLPDSICALYNLETLLLSSCIYLKELPLQMEKLINLRHLDISNTSHLKIPLHLSKLKSLQVLVGAKFLLSGWRMEDLGEAQNLYGSLSVVELQNVVDRREAVKAKMREKNHVDKLSLEWSESSSADNSQTERDILDELRPHKNIKEVEITGYRGTIFPNWLADPLFLKLVKLSLSYCTDCYSLPALGQLPSLKILSVKGMHGITEVREEFYGSLSSKKPFNCLEKLEFEDMAEWKQWHVLGIGEFPTLERLLIKNCPEVSLETPIQLSSLKRFEVSGSPKVGVVFDDAQLFRSQLEGMKQIEELFIRNCNSVTSFPFSILPTTLKRIEISGCK

Gene3D: G3DSA:3.80.10.10
535-678 G3DSA:3.80.10.10

EFEKLTPLYKLEQLRTLLPTCISVNNCYHRLSKRVQLNILPRLRSLRVLSLSHYMIMELPNDLFIKLKLLRFLDLSETGITKLPDSICALYNLETLLLSSCIYLKELPLQMEKLINLRHLDISNTSHLKIPLHLSKLKSLQVLV

FPrintScan: PR00364
IPR000767
646-662 DISEASERSIST
Disease resistance protein

EKLINLRHLDISNTSHL

Gene3D: G3DSA:3.80.10.10
782-827 G3DSA:3.80.10.10

LKLVKLSLSYCTDCYSLPALGQLPSLKILSVKGMHGITEVREEFYG

Gene3D: G3DSA:3.80.10.10
858-1075 G3DSA:3.80.10.10

GEFPTLERLLIKNCPEVSLETPIQLSSLKRFEVSGSPKVGVVFDDAQLFRSQLEGMKQIEELFIRNCNSVTSFPFSILPTTLKRIEISGCKKLKLEAMSYCNMFLKYCISPELLPRARSLRVEYCQNFTKFLIPTATESLCIWNCGYVEKLSVACGGSQMTSLSIWGCRKLKWLPERMQELLPSLNTLHLVFCPEIESFPEGGLPFNLQVLQISGCKK

superfamily: SSF52047
882-1074 SSF52047,LRR

LSSLKRFEVSGSPKVGVVFDDAQLFRSQLEGMKQIEELFIRNCNSVTSFPFSILPTTLKRIEISGCKKLKLEAMSYCNMFLKYCISPELLPRARSLRVEYCQNFTKFLIPTATESLCIWNCGYVEKLSVACGGSQMTSLSIWGCRKLKWLPERMQELLPSLNTLHLVFCPEIESFPEGGLPFNLQVLQISGCK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox