PRGDB00047259 (disease resistance protein R3a-like protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein R3a-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 157280338 (EF613524)
Gene Class NL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS
Gene Species Solanum demissum

Comment?

Solanum demissum isolate 177F22b disease resistance protein R3a-like protein gene, partial cds.

DNA Sequence

CACATTTAAAGCAATGTTTTTCTTATTGTGCAATCTTTCCCAAAGATTATCCATTTCGGAAAGAACAAGTCATTCAGCTGTGGATTGCTAATGGTCTATTAAAGGGGTTGCAAAAAGATGAAACAATTGAAGACTTAGGCAACCTATACTTTCTCGAGTTGAGATCAAGATCACTTTTCGAAAGGGTCCGGGAGTCTTCTAAAAGGAATGAAGAGGAATTCTTAATGCATGACCTTATCAATGATCTGGCCCAAGTTGCATCTTCAAAACTTTGTATCAGGTTGGAAGATAACGAAGGATCTCATATGTTGGAAAAATGTCGACACCTGTCATATTCATTGGGAGATGGTGTCTTTGAGAAGTTGAAACCACTCTACAAATCAAAGCAGCTGAGGACATTGCTTCCAATCAATATCCAGCGTGGGTACTCATTTCCTTTAAGCAAGAGGGTGTTGTATAACATATTGCCAAGACTAACATCCTTAAGGGCTTTATCATTGTCTCATTATCGGATTAAGGAGTTGCCGAATGACTTGTTTATCACATTAAAACTCCTAAGAATTTTGGACCTTTCTCAGACGGCGATAAGAAAGTTACCAGATTCCATATGTGCATTGTATAACTTGGAGATACTTCTCTTGTCTTCTTGTATATATCTTGAGGAGTTACCGCCGCATATGGAAAAGTTGATCAACTTGCGTCACCTTGACACTACTGGCACTTCTCTCTTGAAGATGCCACTACATCCAAGCAAGTTGAAAAACCTCCATGTGCTAGTAGGATTTAAGTTTATTCTAGGTGGCTGCAATGATTTGAGAATGGTAGATTTAGGTGAACTACACAATTTGCATGGATCTATATCAGTTCTAGAGTTGCAAAATGTGGTTGATAGAAGGGAAGCTCTGAATGCAAACATGATGAAAAAGGAACATGTTGAGATGCTGTCGTTGGAGTGGAGTGAGAGTATTGCTGACAGTTCACAAACTGAAGGAGACATACTCGATAAACTACAACCAAATACAAACATAAAGGAACTGGAAATCGCTGGATATAGAGGGACAAAATTTCCGAATTGGATGGCTGATCATTCATTTCTTAAGCTGGTGGGAGTGTCTCTTAGCAATTGCAACAACTGTGCTTCCTTGCCAGCACTAGGACAACTTCCTTCTTTGAAATTCCTTACCGTTAAAGGGATGCATCGAATAACAGAAGTGAGTGAAGAGTTCTACGGTACGTTGTCATCCAAAAAGCCATTTAACTCTCTTGAGAAGCTTGAATTTGCAGAGATGCCAGAGTGGAAGCAGTGGCATGTACTGGGGAAGGGAGAGTTCCCTGCACTTCATGACTTTTTAATTGAAGATTGCCCCAAGCTGATTGGGAAGTTGCCTGAAAAACTTTGCTCTCTGAGAGGATTGAGAATTTCAAAATGTCCTGAACTCAGTCCGGAGACACTTATCCAACTTTCAAATTTGAAAGAGTTTAAAGTTGTAGCTTCTCCTAAAGTTGGAGTTCTTTTTGATGATGCTCAACTGTTTACATCTCAACTTCAGGGAATGAAACAGATTGTTGAATTATGTATTCATGATTGTCACTCTCTTACCTTCTTACCGATTAGCATTCTTCCGAGTACCTTGAAGAAAATAGAGATATATCATTGCAGGAAACTGAAATTGGAGGCGTCAATGATTTCTAGAGGAGATTGTAACATGTTTCTGGAGAATTTGGTAATATATGGATGTGATTCTATAGATGATATATCACCAGAGTTTGTCCCAAGATCACAGTATTTGAGTGTAAACAGTTGCCCCAACCTTACTAGGCTTTTGATTCCTACTGAGACTGAAAAACTCTATATTTGGCATTGTAAGAATCTTGAAATACTTTCAGTGGCATCTGGAACTCAGACGATGTTGCGTAATTTGAGTATTCGTGACTGTGAGAAGCTGAAGTGGCTGCCAGAATGTATGCAGGAACTCATTCCATCTCTTAAGGAACTAGAACTATGGTTTTGTACAGAAATAGTGTCCTTTCCTGAAGGAGGATTGCCCTTCAATTTACAAGTCCTTAGGATCCACTATTGTAAGAAACTGGTGAATGCGCGAAAGGGGTGGCATTTACAGAGACTCCCCTGTCTCAGAGAGTTAACCATCTTACATGATCGCAGTGACCTTGCTGGTGAAAACTGGGAGTTGCCTTGCTCTATTCGAAGGCTTACCATATCCAATCTGAAAACATTAAGCAGCCAACTTTTCAAAAGTCTTACCTCCCTTGAATATTTATCTACTGGTAACTCACTTCAAATTCAGTCACTGCTGGAAGAAGGGCTTCCCACCTCTCTTTCTCGTCTAACGTTATTTGGCAATCATGAGCTCCATTCCCTACCGATTGAAGGTCTACGACAACTCACTTCACTTCGGGATCTATTCATCTCTTCATGTGATCAACTCCAATCTATTCCAGAATCAGCACTGCCCTCCTCCCTCTCTGCGCTGACCATCCAGAATTGCCATAAACTCCAATACCTTCCGGTAAAAGGGATGCCCACTTCAATCTCTTCACTATCTATTTACGACTGTCCATTGCTCAAACCACTCCTTGAATTTGACAAAGGAGAATACTGGCAAAAAATTGCTCATATTTCCACCATAAATATTGATGGGGAATACCAATAA


Protein sequences

Name Description Sequence
disease resistance protein R3a-like protein disease resistance protein R3a-like protein [Solanum demissum].

HLKQCFSYCAIFPKDYPFRKEQVIQLWIANGLLKGLQKDETIEDLGNLYFLELRSRSLFERVRESSKRNEEEFLMHDLINDLAQVASSKLCIRLEDNEGSHMLEKCRHLSYSLGDGVFEKLKPLYKSKQLRTLLPINIQRGYSFPLSKRVLYNILPRLTSLRALSLSHYRIKELPNDLFITLKLLRILDLSQTAIRKLPDSICALYNLEILLLSSCIYLEELPPHMEKLINLRHLDTTGTSLLKMPLHPSKLKNLHVLVGFKFILGGCNDLRMVDLGELHNLHGSISVLELQNVVDRREALNANMMKKEHVEMLSLEWSESIADSSQTEGDILDKLQPNTNIKELEIAGYRGTKFPNWMADHSFLKLVGVSLSNCNNCASLPALGQLPSLKFLTVKGMHRITEVSEEFYGTLSSKKPFNSLEKLEFAEMPEWKQWHVLGKGEFPALHDFLIEDCPKLIGKLPEKLCSLRGLRISKCPELSPETLIQLSNLKEFKVVASPKVGVLFDDAQLFTSQLQGMKQIVELCIHDCHSLTFLPISILPSTLKKIEIYHCRKLKLEASMISRGDCNMFLENLVIYGCDSIDDISPEFVPRSQYLSVNSCPNLTRLLIPTETEKLYIWHCKNLEILSVASGTQTMLRNLSIRDCEKLKWLPECMQELIPSLKELELWFCTEIVSFPEGGLPFNLQVLRIHYCKKLVNARKGWHLQRLPCLRELTILHDRSDLAGENWELPCSIRRLTISNLKTLSSQLFKSLTSLEYLSTGNSLQIQSLLEEGLPTSLSRLTLFGNHELHSLPIEGLRQLTSLRDLFISSCDQLQSIPESALPSSLSALTIQNCHKLQYLPVKGMPTSISSLSIYDCPLLKPLLEFDKGEYWQKIAHISTINIDGEYQ


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-476 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

HLKQCFSYCAIFPKDYPFRKEQVIQLWIANGLLKGLQKDETIEDLGNLYFLELRSRSLFERVRESSKRNEEEFLMHDLINDLAQVASSKLCIRLEDNEGSHMLEKCRHLSYSLGDGVFEKLKPLYKSKQLRTLLPINIQRGYSFPLSKRVLYNILPRLTSLRALSLSHYRIKELPNDLFITLKLLRILDLSQTAIRKLPDSICALYNLEILLLSSCIYLEELPPHMEKLINLRHLDTTGTSLLKMPLHPSKLKNLHVLVGFKFILGGCNDLRMVDLGELHNLHGSISVLELQNVVDRREALNANMMKKEHVEMLSLEWSESIADSSQTEGDILDKLQPNTNIKELEIAGYRGTKFPNWMADHSFLKLVGVSLSNCNNCASLPALGQLPSLKFLTVKGMHRITEVSEEFYGTLSSKKPFNSLEKLEFAEMPEWKQWHVLGKGEFPALHDFLIEDCPKLIGKLPEKLCSLRGLRISKC

HMMPanther: PTHR23155:SF236
1-476 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

HLKQCFSYCAIFPKDYPFRKEQVIQLWIANGLLKGLQKDETIEDLGNLYFLELRSRSLFERVRESSKRNEEEFLMHDLINDLAQVASSKLCIRLEDNEGSHMLEKCRHLSYSLGDGVFEKLKPLYKSKQLRTLLPINIQRGYSFPLSKRVLYNILPRLTSLRALSLSHYRIKELPNDLFITLKLLRILDLSQTAIRKLPDSICALYNLEILLLSSCIYLEELPPHMEKLINLRHLDTTGTSLLKMPLHPSKLKNLHVLVGFKFILGGCNDLRMVDLGELHNLHGSISVLELQNVVDRREALNANMMKKEHVEMLSLEWSESIADSSQTEGDILDKLQPNTNIKELEIAGYRGTKFPNWMADHSFLKLVGVSLSNCNNCASLPALGQLPSLKFLTVKGMHRITEVSEEFYGTLSSKKPFNSLEKLEFAEMPEWKQWHVLGKGEFPALHDFLIEDCPKLIGKLPEKLCSLRGLRISKC

HMMPfam: PF00931
IPR002182
1-33 NB-ARC,NBS
NB-ARC

HLKQCFSYCAIFPKDYPFRKEQVIQLWIANGLL

Gene3D: G3DSA:3.80.10.10
24-62 G3DSA:3.80.10.10

IQLWIANGLLKGLQKDETIEDLGNLYFLELRSRSLFERV

superfamily: SSF52058
74-553 SSF52058,LRR

LMHDLINDLAQVASSKLCIRLEDNEGSHMLEKCRHLSYSLGDGVFEKLKPLYKSKQLRTLLPINIQRGYSFPLSKRVLYNILPRLTSLRALSLSHYRIKELPNDLFITLKLLRILDLSQTAIRKLPDSICALYNLEILLLSSCIYLEELPPHMEKLINLRHLDTTGTSLLKMPLHPSKLKNLHVLVGFKFILGGCNDLRMVDLGELHNLHGSISVLELQNVVDRREALNANMMKKEHVEMLSLEWSESIADSSQTEGDILDKLQPNTNIKELEIAGYRGTKFPNWMADHSFLKLVGVSLSNCNNCASLPALGQLPSLKFLTVKGMHRITEVSEEFYGTLSSKKPFNSLEKLEFAEMPEWKQWHVLGKGEFPALHDFLIEDCPKLIGKLPEKLCSLRGLRISKCPELSPETLIQLSNLKEFKVVASPKVGVLFDDAQLFTSQLQGMKQIVELCIHDCHSLTFLPISILPSTLKKIEIYHCR

Gene3D: G3DSA:3.80.10.10
150-258 G3DSA:3.80.10.10

VLYNILPRLTSLRALSLSHYRIKELPNDLFITLKLLRILDLSQTAIRKLPDSICALYNLEILLLSSCIYLEELPPHMEKLINLRHLDTTGTSLLKMPLHPSKLKNLHVL

Gene3D: G3DSA:3.80.10.10
265-426 G3DSA:3.80.10.10

LGGCNDLRMVDLGELHNLHGSISVLELQNVVDRREALNANMMKKEHVEMLSLEWSESIADSSQTEGDILDKLQPNTNIKELEIAGYRGTKFPNWMADHSFLKLVGVSLSNCNNCASLPALGQLPSLKFLTVKGMHRITEVSEEFYGTLSSKKPFNSLEKLEF

Gene3D: G3DSA:3.80.10.10
443-607 G3DSA:3.80.10.10

FPALHDFLIEDCPKLIGKLPEKLCSLRGLRISKCPELSPETLIQLSNLKEFKVVASPKVGVLFDDAQLFTSQLQGMKQIVELCIHDCHSLTFLPISILPSTLKKIEIYHCRKLKLEASMISRGDCNMFLENLVIYGCDSIDDISPEFVPRSQYLSVNSCPNLTRL

superfamily: SSF52058
571-878 SSF52058,LRR

LENLVIYGCDSIDDISPEFVPRSQYLSVNSCPNLTRLLIPTETEKLYIWHCKNLEILSVASGTQTMLRNLSIRDCEKLKWLPECMQELIPSLKELELWFCTEIVSFPEGGLPFNLQVLRIHYCKKLVNARKGWHLQRLPCLRELTILHDRSDLAGENWELPCSIRRLTISNLKTLSSQLFKSLTSLEYLSTGNSLQIQSLLEEGLPTSLSRLTLFGNHELHSLPIEGLRQLTSLRDLFISSCDQLQSIPESALPSSLSALTIQNCHKLQYLPVKGMPTSISSLSIYDCPLLKPLLEFDKGEYWQKIAH

Gene3D: G3DSA:3.80.10.10
615-860 G3DSA:3.80.10.10

KLYIWHCKNLEILSVASGTQTMLRNLSIRDCEKLKWLPECMQELIPSLKELELWFCTEIVSFPEGGLPFNLQVLRIHYCKKLVNARKGWHLQRLPCLRELTILHDRSDLAGENWELPCSIRRLTISNLKTLSSQLFKSLTSLEYLSTGNSLQIQSLLEEGLPTSLSRLTLFGNHELHSLPIEGLRQLTSLRDLFISSCDQLQSIPESALPSSLSALTIQNCHKLQYLPVKGMPTSISSLSIYDCPL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox