PRGDB00047260 (disease resistance protein R3a-like protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein R3a-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 157280336 (EF613523)
Gene Class NL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, Others
Gene Species Solanum demissum

Comment?

Solanum demissum isolate 177F22a disease resistance protein R3a-like protein gene, partial cds.

DNA Sequence

ATGGAGATTGGCTTAGCAGTTGGTGGTGCATTTCTCTCTTCAGCTTTGAATGTTCTCTTTGATAGGCTTGCTCTTCACGGTGATCTGTTCAACATGTTTCAGAAGCATAAGCATCATGTTCGGCTCTTAAAGAAGCTGAGGATGACTTTGCTTGGCCTGCAGGCTGTGGTAAGTGATGCACAGAATAAGCAAGCATCAAATCCATACGTGAGTCAGTGGCTTAATGAGATTCAAGATGCTGTGGATGGTGCTGAGAACTTAATAGAAGAAGTCAATTTTGAAGCTTTGAGACTTAAGGTGGAAGGTCAGCATCAAAATTTTGCAAACACAATAAGCAACCAGCAGGTAAGTGACCTCAACCGGTGCTTGGGTGATGATTTTTTTCCTAACATAAAGGAGAAGTTGGAAGACACCATTGAAACATTGGAAGAGTTGGAAAAGCAAATTGGTCGCCTTGGCCTAAGGGAATATCTTGATTCGGGTAAACAAGATAACAGAAGACCTTCAACTTCTTTGGTTGATGAATCTGATATCTTAGGTAGACAGAATGAAATAGAGGAATTGATTGATCGTTTATTGTCTGATGATGCCAATGGAAAAAATCTCTCTGTAGTTCCTGTTGTTGGAATGGGGGGCGTGGGCAAGACAACACTTGCTAAAGCTGTTTACAATGATGAGAAGGTAAAAGACCATTTTGGTTTAAAAGCTTGGATTTGTGTGTCTGAACCATATGATGCTGTCAGAATAACAAAAGAGCTACTTCAAGAAATTAGCTCATCTGACTGTACGGTTAATAGCAATCTTAATCAGCTTCAGATCAAATTGAAGGAAAGCTTAAAAGGCAAAAAGTTTCTTATTGTTTTAGATGATGTCTGGAATGAAAACTATGATGAGTGGGATGACTTGAGAAACATTTTTGTTCAAGGAGATATAGGAAGTAAGATCATTGTGACGACACGTAAGGAGAGTGTTGCCTTGATGATGGGTTGTGGGGCAGTCAACGTGGGGACTCTGTCTAGTGAAGTCTCTTGGGCTTTATTCAAACGACATTCATTAGAAAACAGGGGTCCTGAGGAACATCTAGAGCTTGAAGAGGTTGGAAAACAAATTGCACACAAGTGCAAAGGATTGCCATTAGCTCTAAAGGCACTTGCTGGCATTTTACGCTCCAAATCAGATTTGAATGAGTGGAGAGACATATTAAGAAGTGAAATATGGGAACTGCCAAGTCATTCGAATGGTATCTTACCAGCATTGATGTTGAGCTATAATGATCTTCCTGCACACTTGAAGCGGTGTTTTGCTTTTTGTGCAATATATCCCAAAGATTATATGTTTTGCAAAGAACAAGTTATTCACCTATGGATTGCTAATGGTCTTGTACCGCAGTTGGATTCAGGTAACCAATACTTTCTTGAGTTGAGATCWAGATCATTGTTTGAAAGAATCCCAGAGTCTTCTAAATGGAATTCAGAGGAATTCTTAATGCATGACCTTGTCAACGATTTGGCCCAAATTGCATCTTCAAATCTTTGTATTAGGTTGGAAGAGAACCAAGGATCTCATATGTTGGAACAAAGTCGACACATTTCTTATTCAACGGGAGAAGGTGACTTCGAGAAATTGAAACCACTCTTCAAATCAGAGCAGCTGAGGACATTGCTTCCAATCAGTATCCAGCGGGATTACCTATTTAAGCTAAGCAAGAGGGTGCTGCATAATGTATTGCCAAGACTAACATCCTTAAGGGCATTATCGTTGTCACCTTATAAGATTGTGGAGTTGCCAAATGACTTGTTTATCAAATTAAAGCTCCTCAGATTTTTGGATATTTCTCGGACAAAGATTAAAAAGTTGCCAGATTCCATTTGTGTATTGTATAACTTAGAGATACTTCTCTTGTCATCTTGTGATGATCTTGAGGAGCTACCACTGCAGATGGAAAAGTTGATCAACTTGCATTATCTTGACATAAGCAACACTTCTCGCTTGAAGATGCCGCTACATCTGAGCAAGTTGAAAAGCCTCCATGTGCTAGTGGGAGCCAAGTTTCTTCTAGGTGGCCGCGGTGGTTCGAGAATGGATGATTTGGGTGGAGTACATAACTTGTTTGGATCTCTATCAATTCTAGAGTTGCAAAATGTGGTTGATAGATGGGAAGCTCTGAAGGCAAACATGAAGGAGAAGAATCATGTTGAGATGTTATCATTGGAGTGGAGCAGAAGTATTGCTGACAATTCTAAAAATGAAAAGGAAATACTTGATGGGCTACAACCAAATACAAACATAAATGAACTCCAAATCGGTGGATATAGAGGAACAAAATTCCCAAACTGGCTAGCTGATCAATCGTTTCTTAAGCTAGTACAATTGTCTCTTAGCAACTGCAAGGACTGTGATTCCTTGCCAGCACTGGGACAACTTCCTTCTTTGAAATTCCTTGCCATTAGAAGGATGCATCGAATAATAGAGGTGACTCAAGAATTCTATGGTAGTTTGTCTTCCAAAAAGCCATTTAACTCTCTTGAGAAGCTTGAATTTGCAGAGATGCTGGAGTGGAAGCGGTGGCATGTACTAGGGAATGGAGAGTTCCCTGCACTTAAGATCCTTTCAGTTGAGGATTGCCCCAAGTTGATTGAGAAGTTCCCCGAAAATCTTTCTTCTCTGACAGGATTGAGAATTTCAAAATGCCCTGAACTCAGCTTGGAGACATCTATCCAACTTTCAACTTTAAAAATATTTGAAGTTATTAGTTCTCCTAAGGTTGGAGTTCTTTTTGATGACACTGAACTGTTTACATCCCAACTTCAGGAAATGAAACATATTGTTGAATTGTTTTTTACTGATTGTAACTCGCTTACCTCCTTACCTATTAGCATTCTGCCAAGTACCTTGAAGAGAATACACATATATCAGTGCGAGAAACTGAAATTGAAGATGCCAGTTGGTGAGATGATTACTAATAACATGTTTCTCGAGGAGTTGAAACTGGATGGATGTGATTCCATAGATGATATATCACCCGAGTTGGTCCCAAGAGTAGGCACTTTGATAGTTGGGCGTTGCCACAGCCTTACTAGACTTTTGATTCCTACTGAGACTAAAAGTCTCACTATTTGGTCTTGTGAGAATCTTGAAATACTTTCAGTGGCATGTGGGGCTCAGATGATGTCGTTGCGTTTTTTGAATATTGAAAACTGTGAGAAGCTGAAGTGGCTGCCTGAACGCATGCAGGAACTCCTTCCATCTCTTAATACGCTGGAACTCTTTAATTGTCCAGAAATGATGTCCTTTCCTGAAGGAGGATTGCCCTTCAATTTACAAGTCCTTTTAATCTGGAATTGCAAGAAACTGGTGAATGGCCGAAAGAATTGGCGTTTACAGAGGCTCCCCTGTCTTAGAGAGTTAAGGATCGAACACGATGGCAGTGATGAAGAGATTCTTGCTGGTGAGAATTGGGAGTTGCCTTGCTCTATTCAACGTCTTTACATATCTAATCTGAAAACTTTAAGCAGTCAAGTTCTCAAAAGCCTCACCTCTCTTGCGTATCTAGATACTTATTATTTACCTCAAATTCAGTCACTGCTGGAAGAAGGGCTTCCCTCATCTCTTTATGAGCTACGTTTAGATGACCATCATGAGTTTCTTTCACTACCGACCGAATGTCTTCGACACCTCACTTCGCTTCAACGTCTAGAGATCAGGCACTGCAATCAACTCCAATCTCTTTCAGAATCAACTCTGCCCCCCTCCCTCTCTGAGCTGACCATCGGGTATTGCCCTAATCTCCAGTCCCTTCCAGTAAAAGGGATGCCCTCTTCCCTCTCTAAACTACATATTTACAACTGCCCGTTGCTCAAACCACTACTAGAATGTGACAAGGGGGAGTACTGGCAAAAAATTGCTCATATCTCCACCA


Protein sequences

Name Description Sequence
disease resistance protein R3a-like protein disease resistance protein R3a-like protein [Solanum demissum].

MEIGLAVGGAFLSSALNVLFDRLALHGDLFNMFQKHKHHVRLLKKLRMTLLGLQAVVSDAQNKQASNPYVSQWLNEIQDAVDGAENLIEEVNFEALRLKVEGQHQNFANTISNQQVSDLNRCLGDDFFPNIKEKLEDTIETLEELEKQIGRLGLREYLDSGKQDNRRPSTSLVDESDILGRQNEIEELIDRLLSDDANGKNLSVVPVVGMGGVGKTTLAKAVYNDEKVKDHFGLKAWICVSEPYDAVRITKELLQEISSSDCTVNSNLNQLQIKLKESLKGKKFLIVLDDVWNENYDEWDDLRNIFVQGDIGSKIIVTTRKESVALMMGCGAVNVGTLSSEVSWALFKRHSLENRGPEEHLELEEVGKQIAHKCKGLPLALKALAGILRSKSDLNEWRDILRSEIWELPSHSNGILPALMLSYNDLPAHLKRCFAFCAIYPKDYMFCKEQVIHLWIANGLVPQLDSGNQYFLELRSRSLFERIPESSKWNSEEFLMHDLVNDLAQIASSNLCIRLEENQGSHMLEQSRHISYSTGEGDFEKLKPLFKSEQLRTLLPISIQRDYLFKLSKRVLHNVLPRLTSLRALSLSPYKIVELPNDLFIKLKLLRFLDISRTKIKKLPDSICVLYNLEILLLSSCDDLEELPLQMEKLINLHYLDISNTSRLKMPLHLSKLKSLHVLVGAKFLLGGRGGSRMDDLGGVHNLFGSLSILELQNVVDRWEALKANMKEKNHVEMLSLEWSRSIADNSKNEKEILDGLQPNTNINELQIGGYRGTKFPNWLADQSFLKLVQLSLSNCKDCDSLPALGQLPSLKFLAIRRMHRIIEVTQEFYGSLSSKKPFNSLEKLEFAEMLEWKRWHVLGNGEFPALKILSVEDCPKLIEKFPENLSSLTGLRISKCPELSLETSIQLSTLKIFEVISSPKVGVLFDDTELFTSQLQEMKHIVELFFTDCNSLTSLPISILPSTLKRIHIYQCEKLKLKMPVGEMITNNMFLEELKLDGCDSIDDISPELVPRVGTLIVGRCHSLTRLLIPTETKSLTIWSCENLEILSVACGAQMMSLRFLNIENCEKLKWLPERMQELLPSLNTLELFNCPEMMSFPEGGLPFNLQVLLIWNCKKLVNGRKNWRLQRLPCLRELRIEHDGSDEEILAGENWELPCSIQRLYISNLKTLSSQVLKSLTSLAYLDTYYLPQIQSLLEEGLPSSLYELRLDDHHEFLSLPTECLRHLTSLQRLEIRHCNQLQSLSESTLPPSLSELTIGYCPNLQSLPVKGMPSSLSKLHIYNCPLLKPLLECDKGEYWQKIAHIST

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
14-1291 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SALNVLFDRLALHGDLFNMFQKHKHHVRLLKKLRMTLLGLQAVVSDAQNKQASNPYVSQWLNEIQDAVDGAENLIEEVNFEALRLKVEGQHQNFANTISNQQVSDLNRCLGDDFFPNIKEKLEDTIETLEELEKQIGRLGLREYLDSGKQDNRRPSTSLVDESDILGRQNEIEELIDRLLSDDANGKNLSVVPVVGMGGVGKTTLAKAVYNDEKVKDHFGLKAWICVSEPYDAVRITKELLQEISSSDCTVNSNLNQLQIKLKESLKGKKFLIVLDDVWNENYDEWDDLRNIFVQGDIGSKIIVTTRKESVALMMGCGAVNVGTLSSEVSWALFKRHSLENRGPEEHLELEEVGKQIAHKCKGLPLALKALAGILRSKSDLNEWRDILRSEIWELPSHSNGILPALMLSYNDLPAHLKRCFAFCAIYPKDYMFCKEQVIHLWIANGLVPQLDSGNQYFLELRSRSLFERIPESSKWNSEEFLMHDLVNDLAQIASSNLCIRLEENQGSHMLEQSRHISYSTGEGDFEKLKPLFKSEQLRTLLPISIQRDYLFKLSKRVLHNVLPRLTSLRALSLSPYKIVELPNDLFIKLKLLRFLDISRTKIKKLPDSICVLYNLEILLLSSCDDLEELPLQMEKLINLHYLDISNTSRLKMPLHLSKLKSLHVLVGAKFLLGGRGGSRMDDLGGVHNLFGSLSILELQNVVDRWEALKANMKEKNHVEMLSLEWSRSIADNSKNEKEILDGLQPNTNINELQIGGYRGTKFPNWLADQSFLKLVQLSLSNCKDCDSLPALGQLPSLKFLAIRRMHRIIEVTQEFYGSLSSKKPFNSLEKLEFAEMLEWKRWHVLGNGEFPALKILSVEDCPKLIEKFPENLSSLTGLRISKCPELSLETSIQLSTLKIFEVISSPKVGVLFDDTELFTSQLQEMKHIVELFFTDCNSLTSLPISILPSTLKRIHIYQCEKLKLKMPVGEMITNNMFLEELKLDGCDSIDDISPELVPRVGTLIVGRCHSLTRLLIPTETKSLTIWSCENLEILSVACGAQMMSLRFLNIENCEKLKWLPERMQELLPSLNTLELFNCPEMMSFPEGGLPFNLQVLLIWNCKKLVNGRKNWRLQRLPCLRELRIEHDGSDEEILAGENWELPCSIQRLYISNLKTLSSQVLKSLTSLAYLDTYYLPQIQSLLEEGLPSSLYELRLDDHHEFLSLPTECLRHLTSLQRLEIRHCNQLQSLSESTLPPSLSELTIGYCPNLQSLPVKGMPSSLSKLHIYNCPLLKPLLE

HMMPanther: PTHR23155:SF236
14-1291 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

SALNVLFDRLALHGDLFNMFQKHKHHVRLLKKLRMTLLGLQAVVSDAQNKQASNPYVSQWLNEIQDAVDGAENLIEEVNFEALRLKVEGQHQNFANTISNQQVSDLNRCLGDDFFPNIKEKLEDTIETLEELEKQIGRLGLREYLDSGKQDNRRPSTSLVDESDILGRQNEIEELIDRLLSDDANGKNLSVVPVVGMGGVGKTTLAKAVYNDEKVKDHFGLKAWICVSEPYDAVRITKELLQEISSSDCTVNSNLNQLQIKLKESLKGKKFLIVLDDVWNENYDEWDDLRNIFVQGDIGSKIIVTTRKESVALMMGCGAVNVGTLSSEVSWALFKRHSLENRGPEEHLELEEVGKQIAHKCKGLPLALKALAGILRSKSDLNEWRDILRSEIWELPSHSNGILPALMLSYNDLPAHLKRCFAFCAIYPKDYMFCKEQVIHLWIANGLVPQLDSGNQYFLELRSRSLFERIPESSKWNSEEFLMHDLVNDLAQIASSNLCIRLEENQGSHMLEQSRHISYSTGEGDFEKLKPLFKSEQLRTLLPISIQRDYLFKLSKRVLHNVLPRLTSLRALSLSPYKIVELPNDLFIKLKLLRFLDISRTKIKKLPDSICVLYNLEILLLSSCDDLEELPLQMEKLINLHYLDISNTSRLKMPLHLSKLKSLHVLVGAKFLLGGRGGSRMDDLGGVHNLFGSLSILELQNVVDRWEALKANMKEKNHVEMLSLEWSRSIADNSKNEKEILDGLQPNTNINELQIGGYRGTKFPNWLADQSFLKLVQLSLSNCKDCDSLPALGQLPSLKFLAIRRMHRIIEVTQEFYGSLSSKKPFNSLEKLEFAEMLEWKRWHVLGNGEFPALKILSVEDCPKLIEKFPENLSSLTGLRISKCPELSLETSIQLSTLKIFEVISSPKVGVLFDDTELFTSQLQEMKHIVELFFTDCNSLTSLPISILPSTLKRIHIYQCEKLKLKMPVGEMITNNMFLEELKLDGCDSIDDISPELVPRVGTLIVGRCHSLTRLLIPTETKSLTIWSCENLEILSVACGAQMMSLRFLNIENCEKLKWLPERMQELLPSLNTLELFNCPEMMSFPEGGLPFNLQVLLIWNCKKLVNGRKNWRLQRLPCLRELRIEHDGSDEEILAGENWELPCSIQRLYISNLKTLSSQVLKSLTSLAYLDTYYLPQIQSLLEEGLPSSLYELRLDDHHEFLSLPTECLRHLTSLQRLEIRHCNQLQSLSESTLPPSLSELTIGYCPNLQSLPVKGMPSSLSKLHIYNCPLLKPLLE

superfamily: SSF52540
161-410 SSF52540

GKQDNRRPSTSLVDESDILGRQNEIEELIDRLLSDDANGKNLSVVPVVGMGGVGKTTLAKAVYNDEKVKDHFGLKAWICVSEPYDAVRITKELLQEISSSDCTVNSNLNQLQIKLKESLKGKKFLIVLDDVWNENYDEWDDLRNIFVQGDIGSKIIVTTRKESVALMMGCGAVNVGTLSSEVSWALFKRHSLENRGPEEHLELEEVGKQIAHKCKGLPLALKALAGILRSKSDLNEWRDILRSEIWELPS

Gene3D: G3DSA:3.40.50.300
173-317 G3DSA:3.40.50.300

VDESDILGRQNEIEELIDRLLSDDANGKNLSVVPVVGMGGVGKTTLAKAVYNDEKVKDHFGLKAWICVSEPYDAVRITKELLQEISSSDCTVNSNLNQLQIKLKESLKGKKFLIVLDDVWNENYDEWDDLRNIFVQGDIGSKIIV

HMMPfam: PF00931
IPR002182
181-463 NB-ARC,NBS
NB-ARC

RQNEIEELIDRLLSDDANGKNLSVVPVVGMGGVGKTTLAKAVYNDEKVKDHFGLKAWICVSEPYDAVRITKELLQEISSSDCTVNSNLNQLQIKLKESLKGKKFLIVLDDVWNENYDEWDDLRNIFVQGDIGSKIIVTTRKESVALMMGCGAVNVGTLSSEVSWALFKRHSLENRGPEEHLELEEVGKQIAHKCKGLPLALKALAGILRSKSDLNEWRDILRSEIWELPSHSNGILPALMLSYNDLPAHLKRCFAFCAIYPKDYMFCKEQVIHLWIANGLVPQ

FPrintScan: PR00364
IPR000767
204-219 DISEASERSIST
Disease resistance protein

VVPVVGMGGVGKTTLA

FPrintScan: PR00364
IPR000767
278-292 DISEASERSIST
Disease resistance protein

SLKGKKFLIVLDDVW

FPrintScan: PR00364
IPR000767
374-388 DISEASERSIST
Disease resistance protein

CKGLPLALKALAGIL

superfamily: SSF52058
495-974 SSF52058,LRR

LMHDLVNDLAQIASSNLCIRLEENQGSHMLEQSRHISYSTGEGDFEKLKPLFKSEQLRTLLPISIQRDYLFKLSKRVLHNVLPRLTSLRALSLSPYKIVELPNDLFIKLKLLRFLDISRTKIKKLPDSICVLYNLEILLLSSCDDLEELPLQMEKLINLHYLDISNTSRLKMPLHLSKLKSLHVLVGAKFLLGGRGGSRMDDLGGVHNLFGSLSILELQNVVDRWEALKANMKEKNHVEMLSLEWSRSIADNSKNEKEILDGLQPNTNINELQIGGYRGTKFPNWLADQSFLKLVQLSLSNCKDCDSLPALGQLPSLKFLAIRRMHRIIEVTQEFYGSLSSKKPFNSLEKLEFAEMLEWKRWHVLGNGEFPALKILSVEDCPKLIEKFPENLSSLTGLRISKCPELSLETSIQLSTLKIFEVISSPKVGVLFDDTELFTSQLQEMKHIVELFFTDCNSLTSLPISILPSTLKRIHIYQCE

Gene3D: G3DSA:3.80.10.10
570-687 G3DSA:3.80.10.10

RVLHNVLPRLTSLRALSLSPYKIVELPNDLFIKLKLLRFLDISRTKIKKLPDSICVLYNLEILLLSSCDDLEELPLQMEKLINLHYLDISNTSRLKMPLHLSKLKSLHVLVGAKFLLG

FPrintScan: PR00364
IPR000767
648-664 DISEASERSIST
Disease resistance protein

EKLINLHYLDISNTSRL

Gene3D: G3DSA:3.80.10.10
751-835 G3DSA:3.80.10.10

KEILDGLQPNTNINELQIGGYRGTKFPNWLADQSFLKLVQLSLSNCKDCDSLPALGQLPSLKFLAIRRMHRIIEVTQEFYGSLSS

Gene3D: G3DSA:3.80.10.10
867-901 G3DSA:3.80.10.10

LKILSVEDCPKLIEKFPENLSSLTGLRISKCPELS

Gene3D: G3DSA:3.80.10.10
934-1100 G3DSA:3.80.10.10

SQLQEMKHIVELFFTDCNSLTSLPISILPSTLKRIHIYQCEKLKLKMPVGEMITNNMFLEELKLDGCDSIDDISPELVPRVGTLIVGRCHSLTRLLIPTETKSLTIWSCENLEILSVACGAQMMSLRFLNIENCEKLKWLPERMQELLPSLNTLELFNCPEMMSFPE

superfamily: SSF52058
992-1303 SSF52058,LRR

LEELKLDGCDSIDDISPELVPRVGTLIVGRCHSLTRLLIPTETKSLTIWSCENLEILSVACGAQMMSLRFLNIENCEKLKWLPERMQELLPSLNTLELFNCPEMMSFPEGGLPFNLQVLLIWNCKKLVNGRKNWRLQRLPCLRELRIEHDGSDEEILAGENWELPCSIQRLYISNLKTLSSQVLKSLTSLAYLDTYYLPQIQSLLEEGLPSSLYELRLDDHHEFLSLPTECLRHLTSLQRLEIRHCNQLQSLSESTLPPSLSELTIGYCPNLQSLPVKGMPSSLSKLHIYNCPLLKPLLECDKGEYWQKIAH

Gene3D: G3DSA:3.80.10.10
1163-1284 G3DSA:3.80.10.10

YISNLKTLSSQVLKSLTSLAYLDTYYLPQIQSLLEEGLPSSLYELRLDDHHEFLSLPTECLRHLTSLQRLEIRHCNQLQSLSESTLPPSLSELTIGYCPNLQSLPVKGMPSSLSKLHIYNCP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox