PRGDB00047262 (disease resistance protein R3a-like protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein R3a-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 157280330 (EF613519)
Gene Class NL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, Others
Gene Species Solanum demissum

Comment?

Solanum demissum isolate 10I24d disease resistance protein R3a-like protein gene, complete cds.

DNA Sequence

ATGGAGATTGGGTTAGCAGTTGGTGGTGCATTTCTCTCTTCAGCTTTGAATGTTCTCTTTGATAGGCTTGCTCCTCACGGTGATCTGCTCAACATGTTTCGGAAGCATACAGATGATGTTCAGCTCTTTGAGAAGCTGGGGGACATTTTGCTTGGTCTTCAAATTGTGCTAAGTGATGCAGAGAATAAGAAATCATCAAATCAATTTGTGAGCCAGTGGTTAAATAAGCTTCAGAGTGCTGTGGACGGTGCTGAAAACTTGATAGAACAACTCAATTATGAAGCTTTGAGGCTTAAAGTGGAAGGTCAGCTTCAAAATCTTGCAGAAACAAGCAACCAGCAAGTAAGTGATGATTTCTTTCTTAACATAAAGAAGAAGTTGGAAGACACTATTAAAAAATTGGAGGTGTTGGTAAAGCAAATTGGTCGCCTTGGCATAAAGGAGCATTATGTTTCGACTAAACAAGAAACTAGAACACCTTCAACTTCTTTGGTTGATGATGCTGGTATCTTTGGAAGGCAGAATGAAATAGAGAATTTGATTGGCCGTTTATTGTCTAAGGATACAAAGGGAAAAAATCTGGTTGTAGTTCCTATTGTTGGAATGGGCGGCCTGGGTAAGACAACACTTGCTAAAGCCGTCTACAATGATGAGAAGGTGAAGGAGCATTTTGGTTTGAAAGCTTGGTTTTGTGTTTCTGAGGCATATGATGCTTTCAGAATAACAAAAGGTTTACTTCAAGAAATTGGCTCATTTGACTTGAAGGCTGATGACAATCTTAATCAGCTACAAGTCAAATTGAAGGAAAGCTTAAAGGGGAAGAAGTTTCTTATTGTTCTGGATGATGTGTGGAATGACAACTACAATGAGTGGGATGACTTGAAAAATGTTTTTGTACAAGGAGATATAGGAAGTAAGATCATTGTGACGACACGTAAAGCGAGTGTTGCCTTGATGATGGGTAGTGAGACAATTAACATGGGGACTCTGTCTGATGAAGCCTCTTGGGATCTATTCAAACGACATTCACTAGAAAACAGGGATCCTAAAGAACATCCAGAACTTGAAGAGATTGGAAAACAAATTGCAGACAAGTGCAAAGGGTTGCCTTTAGCTCTAAAGGCACTTGCTGGTGTTTTACGTGGCAAATCAGAGGTGGATGAGTGGAGAGACATTTTAAGAAGTGAAATATGGGAGCTGCCAAGTTGTTTGAATGGTATATTACCAGCGTTGATGTTGAGCTACAATGATCTTCCTGCACATTTGAAGCAATGTTTTGCTTATTGTGCAATATATCCCAAAGATTATCAATTTTGCAAAGACCAAGTTATTCACCTGTGGATTGCTAATGGTCTAGTACAGCAGTTTCATTCAGGTAACCAATACTTTCTCGAGTTGAGATCAAGATCACTGTTCGAAATGGTCTCGGAGTCTTCTGAATGGAATTCAGAGAAATTCTTAATGCATGACCTTGTCAATGATTTGGCCCAAATTGCATCTTCAAATCTTTGTATAAAGTTGGAAGATAACAAAGGATCACATATGTTGGAACAATGTCGGCACATGTCCTATTCAATAGGAGAAGGTGGTGACTTTGAGAAATTGAAATCACTCTTTAAATCAGAGAAGCTGAGGACATTACTTCCAATCGATATCCAGTTTCTTTACAAAATTAAGCTAAGCAAGAGGGTGCTGCATAACATATTGCCAAGACTAACATCCTTAAGGGCATTATCGTTGTCACATTTCGAAATTGTTGAGTTGCCATATGACTTGTTTATCGAATTAAAGCTCCTGAGACTTTTGGATATTTCTCGGACACAGATTAAAAGGTTGCCAGATTCGATTTGTGTGTTGTATAACTTAGAGACACTTCTCCTGTCATCTTGTGCTGATCTTGAGGAGCTACCGCTGCAGATGGAGAAGTTGATTAACTTGCGTCATCTGGACATAAGCAACACTTGTCTCTTGAAGATGCCGCTACATCTGAGCAAGTTGAAAAGCCTCCAAGTGTTAGTGGGAGCCAAATTTCTTGTAGGTGGTTTGAGAATGGAAGATTTGGGTGAAGTACATAACTTGTACGGATCTCTATCAGTTGTAGAGTTGCAAAATGTGGTTGATAGTAGGGAAGCTGTGAAGGCAAAGATGAGGGAGAAGAATCATGTTGACAAGTTATCATTGGAGTGGAGTGAAAGTAGTAGTGCCGACAATTCACAAACAGAAAGAGACATACTTGATGAGCTACGCCCACATAAAAACATTAAAGTAGTCAAAATCACTGGATATAGAGGGACAAACTTTCCCAATTGGCTAGCTGAACCTTTGTTTCTTAAGCTGGTGAAATTGTCTCTTAGAAACTGCAAGAACTGTTATTCCTTGCCAGCACTAGGACAACTCCCTTGTTTGAAATTCCTTTCAATTAGAGGGATGCATGGAATAACAGAGGTGACGGAAGAATTCTATGGCAGTTGGTCCTCCAAAAAGCCTTTTAACTGTCTTGAGAAGCTTAAATTTAAAGATATGCCGGAGTGGAAGCAATGGGACCTACTAGGAAGTGGAGAGTTCCCTATACTTGAGAAGCTTTTGATTGAAAATTGCCCTGAACTCTGTTTGGAGACAGTACCCATCCAACTTTCAAGTTTAAAAAGTTTTGAAGTAATTGGTTCTCCCATGGTTGGAGTTGTTTTTTATGATGCCCAACTTGAGGGAATGAAGCAGATTGAGGAATTACGTATTAGTGATTGTAACTCTCTTACCTCCTTTCCTTTTAGCATACTGCCCACTACCTTGAAGAGAATAATGATATCTGATTGCCAGAAATTGAAATTAGAACAGCCAGTTGGTGAGATGAGTATGTTTCTCGAGTATTTGACACTGGAGAACTGTGGTTGTATAGATGATATATCACTTGAGTTGCTCCCAAGAGCACGCGAATTGAATGTATTTAGTTGCCACAACCCTAGTAGGTTTTTGATTCCTACTGCCACTGAAACTCTCTATATTTGGAATTGTAAGAATGTTGAAAAACTTTCAGTGGCATGTGGGGGGACCCAGATGACGTCACTGATTATTGATGGCTGTTTGAAGCTGAAGTGGCTGCCAGAACGTATGCAGGAACTCCTTCCATCTCTTAAGGAACTGGTACTGTTTGATTGTCCAGAAATAGAGTCCTTTCCTGAAGGAGGATTGCCCTTCAATTTACAACAACTTGCGATCAGATATTGCAAGAAACTGGTGAACGGCCGAAAGGAGTGGCATTTACAGAGACTCCCCTGTCTCAAATGGTTAAGCATCTCTCATGATGGCAGTGACGAAGAGATTGTTGGTGGTGAGAATTGGGAGTTGCCTTCCTCTATTCAAACACTTATCATAAACAATCTGAAAACATTAAGCAGCCAACATCTCAAAAACCTCACCGCTCTTCAATATCTATGTATTGAGGGTAATTTACCTCAAATTCAGTCAATGCTGGAACAAGGCCAGTTTTCGCACCTCACTTCGCTTCAAAGTCTACAAATCTCCTCCCGCCAATCACTTCCTGAATCGGCACTGCCCTCCTCCCTCTCTCAGCTGGGGATCTCCCTTTGCCCTAATCTTCAATCACTTCCTGAATCGGCACTGCCCTCCTCCCTCTCTAAGCTGACCATCTCCCATTGCCCTACGCTCCAATCTCTTCCACTAAAAGGGATGCCCTCCTCCCTCTCTCAGCTGGAGATCTCCCATTGCCCTAATCTCCAATCACTTCCTGAATCGGCACTGCCCTCCTCCCTCTCTCAGCTGACCATCAATAATTGCCCTAATCTCCAATCACTTTCCGAATCAACACTGCCCTCGTCCCTCTCCCAGCTGAAAATTTCCCATTGTCCTAAGCTCCAATCTCTTCCACTAAAAGGGATGCCCTCTTCCCTCTCTGAACTATCTATTGTCGAATGCCCATTGCTCAAACCACTACTAGAATTTGACAAGGGGGAATACTGGCCAAATATTGCTCAATTTCCCACCATAAAGATCGATGGGGAATGCCTCTGA


Protein sequences

Name Description Sequence
disease resistance protein R3a-like protein disease resistance protein R3a-like protein [Solanum demissum].

MEIGLAVGGAFLSSALNVLFDRLAPHGDLLNMFRKHTDDVQLFEKLGDILLGLQIVLSDAENKKSSNQFVSQWLNKLQSAVDGAENLIEQLNYEALRLKVEGQLQNLAETSNQQVSDDFFLNIKKKLEDTIKKLEVLVKQIGRLGIKEHYVSTKQETRTPSTSLVDDAGIFGRQNEIENLIGRLLSKDTKGKNLVVVPIVGMGGLGKTTLAKAVYNDEKVKEHFGLKAWFCVSEAYDAFRITKGLLQEIGSFDLKADDNLNQLQVKLKESLKGKKFLIVLDDVWNDNYNEWDDLKNVFVQGDIGSKIIVTTRKASVALMMGSETINMGTLSDEASWDLFKRHSLENRDPKEHPELEEIGKQIADKCKGLPLALKALAGVLRGKSEVDEWRDILRSEIWELPSCLNGILPALMLSYNDLPAHLKQCFAYCAIYPKDYQFCKDQVIHLWIANGLVQQFHSGNQYFLELRSRSLFEMVSESSEWNSEKFLMHDLVNDLAQIASSNLCIKLEDNKGSHMLEQCRHMSYSIGEGGDFEKLKSLFKSEKLRTLLPIDIQFLYKIKLSKRVLHNILPRLTSLRALSLSHFEIVELPYDLFIELKLLRLLDISRTQIKRLPDSICVLYNLETLLLSSCADLEELPLQMEKLINLRHLDISNTCLLKMPLHLSKLKSLQVLVGAKFLVGGLRMEDLGEVHNLYGSLSVVELQNVVDSREAVKAKMREKNHVDKLSLEWSESSSADNSQTERDILDELRPHKNIKVVKITGYRGTNFPNWLAEPLFLKLVKLSLRNCKNCYSLPALGQLPCLKFLSIRGMHGITEVTEEFYGSWSSKKPFNCLEKLKFKDMPEWKQWDLLGSGEFPILEKLLIENCPELCLETVPIQLSSLKSFEVIGSPMVGVVFYDAQLEGMKQIEELRISDCNSLTSFPFSILPTTLKRIMISDCQKLKLEQPVGEMSMFLEYLTLENCGCIDDISLELLPRARELNVFSCHNPSRFLIPTATETLYIWNCKNVEKLSVACGGTQMTSLIIDGCLKLKWLPERMQELLPSLKELVLFDCPEIESFPEGGLPFNLQQLAIRYCKKLVNGRKEWHLQRLPCLKWLSISHDGSDEEIVGGENWELPSSIQTLIINNLKTLSSQHLKNLTALQYLCIEGNLPQIQSMLEQGQFSHLTSLQSLQISSRQSLPESALPSSLSQLGISLCPNLQSLPESALPSSLSKLTISHCPTLQSLPLKGMPSSLSQLEISHCPNLQSLPESALPSSLSQLTINNCPNLQSLSESTLPSSLSQLKISHCPKLQSLPLKGMPSSLSELSIVECPLLKPLLEFDKGEYWPNIAQFPTIKIDGECL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
11-1313 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FLSSALNVLFDRLAPHGDLLNMFRKHTDDVQLFEKLGDILLGLQIVLSDAENKKSSNQFVSQWLNKLQSAVDGAENLIEQLNYEALRLKVEGQLQNLAETSNQQVSDDFFLNIKKKLEDTIKKLEVLVKQIGRLGIKEHYVSTKQETRTPSTSLVDDAGIFGRQNEIENLIGRLLSKDTKGKNLVVVPIVGMGGLGKTTLAKAVYNDEKVKEHFGLKAWFCVSEAYDAFRITKGLLQEIGSFDLKADDNLNQLQVKLKESLKGKKFLIVLDDVWNDNYNEWDDLKNVFVQGDIGSKIIVTTRKASVALMMGSETINMGTLSDEASWDLFKRHSLENRDPKEHPELEEIGKQIADKCKGLPLALKALAGVLRGKSEVDEWRDILRSEIWELPSCLNGILPALMLSYNDLPAHLKQCFAYCAIYPKDYQFCKDQVIHLWIANGLVQQFHSGNQYFLELRSRSLFEMVSESSEWNSEKFLMHDLVNDLAQIASSNLCIKLEDNKGSHMLEQCRHMSYSIGEGGDFEKLKSLFKSEKLRTLLPIDIQFLYKIKLSKRVLHNILPRLTSLRALSLSHFEIVELPYDLFIELKLLRLLDISRTQIKRLPDSICVLYNLETLLLSSCADLEELPLQMEKLINLRHLDISNTCLLKMPLHLSKLKSLQVLVGAKFLVGGLRMEDLGEVHNLYGSLSVVELQNVVDSREAVKAKMREKNHVDKLSLEWSESSSADNSQTERDILDELRPHKNIKVVKITGYRGTNFPNWLAEPLFLKLVKLSLRNCKNCYSLPALGQLPCLKFLSIRGMHGITEVTEEFYGSWSSKKPFNCLEKLKFKDMPEWKQWDLLGSGEFPILEKLLIENCPELCLETVPIQLSSLKSFEVIGSPMVGVVFYDAQLEGMKQIEELRISDCNSLTSFPFSILPTTLKRIMISDCQKLKLEQPVGEMSMFLEYLTLENCGCIDDISLELLPRARELNVFSCHNPSRFLIPTATETLYIWNCKNVEKLSVACGGTQMTSLIIDGCLKLKWLPERMQELLPSLKELVLFDCPEIESFPEGGLPFNLQQLAIRYCKKLVNGRKEWHLQRLPCLKWLSISHDGSDEEIVGGENWELPSSIQTLIINNLKTLSSQHLKNLTALQYLCIEGNLPQIQSMLEQGQFSHLTSLQSLQISSRQSLPESALPSSLSQLGISLCPNLQSLPESALPSSLSKLTISHCPTLQSLPLKGMPSSLSQLEISHCPNLQSLPESALPSSLSQLTINNCPNLQSLSESTLPSSLSQLKISHCPKLQSLPLKGMPSSLSELSIVECPL

HMMPanther: PTHR23155:SF236
11-1313 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

FLSSALNVLFDRLAPHGDLLNMFRKHTDDVQLFEKLGDILLGLQIVLSDAENKKSSNQFVSQWLNKLQSAVDGAENLIEQLNYEALRLKVEGQLQNLAETSNQQVSDDFFLNIKKKLEDTIKKLEVLVKQIGRLGIKEHYVSTKQETRTPSTSLVDDAGIFGRQNEIENLIGRLLSKDTKGKNLVVVPIVGMGGLGKTTLAKAVYNDEKVKEHFGLKAWFCVSEAYDAFRITKGLLQEIGSFDLKADDNLNQLQVKLKESLKGKKFLIVLDDVWNDNYNEWDDLKNVFVQGDIGSKIIVTTRKASVALMMGSETINMGTLSDEASWDLFKRHSLENRDPKEHPELEEIGKQIADKCKGLPLALKALAGVLRGKSEVDEWRDILRSEIWELPSCLNGILPALMLSYNDLPAHLKQCFAYCAIYPKDYQFCKDQVIHLWIANGLVQQFHSGNQYFLELRSRSLFEMVSESSEWNSEKFLMHDLVNDLAQIASSNLCIKLEDNKGSHMLEQCRHMSYSIGEGGDFEKLKSLFKSEKLRTLLPIDIQFLYKIKLSKRVLHNILPRLTSLRALSLSHFEIVELPYDLFIELKLLRLLDISRTQIKRLPDSICVLYNLETLLLSSCADLEELPLQMEKLINLRHLDISNTCLLKMPLHLSKLKSLQVLVGAKFLVGGLRMEDLGEVHNLYGSLSVVELQNVVDSREAVKAKMREKNHVDKLSLEWSESSSADNSQTERDILDELRPHKNIKVVKITGYRGTNFPNWLAEPLFLKLVKLSLRNCKNCYSLPALGQLPCLKFLSIRGMHGITEVTEEFYGSWSSKKPFNCLEKLKFKDMPEWKQWDLLGSGEFPILEKLLIENCPELCLETVPIQLSSLKSFEVIGSPMVGVVFYDAQLEGMKQIEELRISDCNSLTSFPFSILPTTLKRIMISDCQKLKLEQPVGEMSMFLEYLTLENCGCIDDISLELLPRARELNVFSCHNPSRFLIPTATETLYIWNCKNVEKLSVACGGTQMTSLIIDGCLKLKWLPERMQELLPSLKELVLFDCPEIESFPEGGLPFNLQQLAIRYCKKLVNGRKEWHLQRLPCLKWLSISHDGSDEEIVGGENWELPSSIQTLIINNLKTLSSQHLKNLTALQYLCIEGNLPQIQSMLEQGQFSHLTSLQSLQISSRQSLPESALPSSLSQLGISLCPNLQSLPESALPSSLSKLTISHCPTLQSLPLKGMPSSLSQLEISHCPNLQSLPESALPSSLSQLTINNCPNLQSLSESTLPSSLSQLKISHCPKLQSLPLKGMPSSLSELSIVECPL

superfamily: SSF52540
153-404 SSF52540

TKQETRTPSTSLVDDAGIFGRQNEIENLIGRLLSKDTKGKNLVVVPIVGMGGLGKTTLAKAVYNDEKVKEHFGLKAWFCVSEAYDAFRITKGLLQEIGSFDLKADDNLNQLQVKLKESLKGKKFLIVLDDVWNDNYNEWDDLKNVFVQGDIGSKIIVTTRKASVALMMGSETINMGTLSDEASWDLFKRHSLENRDPKEHPELEEIGKQIADKCKGLPLALKALAGVLRGKSEVDEWRDILRSEIWELPSCL

HMMPfam: PF00931
IPR002182
173-457 NB-ARC,NBS
NB-ARC

RQNEIENLIGRLLSKDTKGKNLVVVPIVGMGGLGKTTLAKAVYNDEKVKEHFGLKAWFCVSEAYDAFRITKGLLQEIGSFDLKADDNLNQLQVKLKESLKGKKFLIVLDDVWNDNYNEWDDLKNVFVQGDIGSKIIVTTRKASVALMMGSETINMGTLSDEASWDLFKRHSLENRDPKEHPELEEIGKQIADKCKGLPLALKALAGVLRGKSEVDEWRDILRSEIWELPSCLNGILPALMLSYNDLPAHLKQCFAYCAIYPKDYQFCKDQVIHLWIANGLVQQFH

Gene3D: G3DSA:3.40.50.300
173-313 G3DSA:3.40.50.300

RQNEIENLIGRLLSKDTKGKNLVVVPIVGMGGLGKTTLAKAVYNDEKVKEHFGLKAWFCVSEAYDAFRITKGLLQEIGSFDLKADDNLNQLQVKLKESLKGKKFLIVLDDVWNDNYNEWDDLKNVFVQGDIGSKIIVTTRK

FPrintScan: PR00364
IPR000767
196-211 DISEASERSIST
Disease resistance protein

VVPIVGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
270-284 DISEASERSIST
Disease resistance protein

SLKGKKFLIVLDDVW

FPrintScan: PR00364
IPR000767
366-380 DISEASERSIST
Disease resistance protein

CKGLPLALKALAGVL

superfamily: SSF52058
471-975 SSF52058,LRR

LFEMVSESSEWNSEKFLMHDLVNDLAQIASSNLCIKLEDNKGSHMLEQCRHMSYSIGEGGDFEKLKSLFKSEKLRTLLPIDIQFLYKIKLSKRVLHNILPRLTSLRALSLSHFEIVELPYDLFIELKLLRLLDISRTQIKRLPDSICVLYNLETLLLSSCADLEELPLQMEKLINLRHLDISNTCLLKMPLHLSKLKSLQVLVGAKFLVGGLRMEDLGEVHNLYGSLSVVELQNVVDSREAVKAKMREKNHVDKLSLEWSESSSADNSQTERDILDELRPHKNIKVVKITGYRGTNFPNWLAEPLFLKLVKLSLRNCKNCYSLPALGQLPCLKFLSIRGMHGITEVTEEFYGSWSSKKPFNCLEKLKFKDMPEWKQWDLLGSGEFPILEKLLIENCPELCLETVPIQLSSLKSFEVIGSPMVGVVFYDAQLEGMKQIEELRISDCNSLTSFPFSILPTTLKRIMISDCQKLKLEQPVGEMSMFLEYLTLENCGCIDDISLELLPR

Gene3D: G3DSA:3.80.10.10
557-705 G3DSA:3.80.10.10

KIKLSKRVLHNILPRLTSLRALSLSHFEIVELPYDLFIELKLLRLLDISRTQIKRLPDSICVLYNLETLLLSSCADLEELPLQMEKLINLRHLDISNTCLLKMPLHLSKLKSLQVLVGAKFLVGGLRMEDLGEVHNLYGSLSVVELQNV

FPrintScan: PR00364
IPR000767
617-633 DISEASERSIST
Disease resistance protein

CVLYNLETLLLSSCADL

Gene3D: G3DSA:3.80.10.10
763-852 G3DSA:3.80.10.10

RGTNFPNWLAEPLFLKLVKLSLRNCKNCYSLPALGQLPCLKFLSIRGMHGITEVTEEFYGSWSSKKPFNCLEKLKFKDMPEWKQWDLLGS

Gene3D: G3DSA:3.80.10.10
878-1002 G3DSA:3.80.10.10

LSSLKSFEVIGSPMVGVVFYDAQLEGMKQIEELRISDCNSLTSFPFSILPTTLKRIMISDCQKLKLEQPVGEMSMFLEYLTLENCGCIDDISLELLPRARELNVFSCHNPSRFLIPTATETLYIW

superfamily: SSF52058
977-1331 SSF52058,LRR

RELNVFSCHNPSRFLIPTATETLYIWNCKNVEKLSVACGGTQMTSLIIDGCLKLKWLPERMQELLPSLKELVLFDCPEIESFPEGGLPFNLQQLAIRYCKKLVNGRKEWHLQRLPCLKWLSISHDGSDEEIVGGENWELPSSIQTLIINNLKTLSSQHLKNLTALQYLCIEGNLPQIQSMLEQGQFSHLTSLQSLQISSRQSLPESALPSSLSQLGISLCPNLQSLPESALPSSLSKLTISHCPTLQSLPLKGMPSSLSQLEISHCPNLQSLPESALPSSLSQLTINNCPNLQSLSESTLPSSLSQLKISHCPKLQSLPLKGMPSSLSELSIVECPLLKPLLEFDKGEYWPNIAQ

Gene3D: G3DSA:3.80.10.10
1003-1313 G3DSA:3.80.10.10

NCKNVEKLSVACGGTQMTSLIIDGCLKLKWLPERMQELLPSLKELVLFDCPEIESFPEGGLPFNLQQLAIRYCKKLVNGRKEWHLQRLPCLKWLSISHDGSDEEIVGGENWELPSSIQTLIINNLKTLSSQHLKNLTALQYLCIEGNLPQIQSMLEQGQFSHLTSLQSLQISSRQSLPESALPSSLSQLGISLCPNLQSLPESALPSSLSKLTISHCPTLQSLPLKGMPSSLSQLEISHCPNLQSLPESALPSSLSQLTINNCPNLQSLSESTLPSSLSQLKISHCPKLQSLPLKGMPSSLSELSIVECPL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox