PRGDB00047266 (disease resistance protein (TIR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 42566972 (NM_118110)
Gene Class TNL
Domain Type TIR, LRR, NBS
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR class), putative (AT4G19920) mRNA, complete cds.

DNA Sequence

ATGGACCCTCCTAGTCCTCCTCCTCCTCCCATTCCTGAATCCCGACCACGACCTCTTACTCCTCCCGTGCTCCTAACCCGACCACGACCTCCTCTTCCTTATGCTCGCCCTCTTCAGCCACCGCAAAGTCTTCCACCCCGACCACGACCCCAGGTGTTTGTTAGTTTCCGAGGAAAGGAGCTGCGCCACGGCTTCGTGAGTCATGTAGTGAAAGCCTTGAGAATTGCAGGGGTCAACGTTTTCATTGATAGCAACGAGATGAAAGGGAGAGACCTTCAAAACCTCTTCAAGAGAATCGAAAACTCAAAGATGGCACTCGTGATCTTCTCTGACCGGTTCTCGGAGTCAGACTGGTGCTTAAACGAGCTCGTGAAGATTGATGATTGCGTGAAGGAAGGGAAACTAACAGTGATCCCTGTCTTCTACAGGGTCAATACAGACGACGTGAAAAATTTCAAAGGTAAATTTGGAAGTTGTTTTATAGAAACGGTGCAGAGACAGTCTCCTAAGGAGGAACCTATGGCCGAACGTTGGGTGAACTCTGTGAAATCTATTTCGTCCAAGACCGGCTTCACCTCAGAAGTCCACAGAATAGATAGCTATCTTGTGGATGCGATTGTTCGGGACGTTAAGAGACAGCTACCATACGTTCCCACTAAAGAGAAGGAATTGCCCATTGAAACAGAGATTTTCTTCGCTCTTGTTTTGGCTGGTCTCTGTAATTTCATAGCACCTTTAATATTCAATGACACGAGTTTCTACAAGACTCCTCAATGGTTTGTAGGTGTTTTGTTTTTGGTTCTAATCCGCAGGAAGTTCGCCTGA


Protein sequences

Name Description Sequence
disease resistance protein (TIR class), putative disease resistance protein (TIR class), putative [Arabidopsis thaliana].

MDPPSPPPPPIPESRPRPLTPPVLLTRPRPPLPYARPLQPPQSLPPRPRPQVFVSFRGKELRHGFVSHVVKALRIAGVNVFIDSNEMKGRDLQNLFKRIENSKMALVIFSDRFSESDWCLNELVKIDDCVKEGKLTVIPVFYRVNTDDVKNFKGKFGSCFIETVQRQSPKEEPMAERWVNSVKSISSKTGFTSEVHRIDSYLVDAIVRDVKRQLPYVPTKEKELPIETEIFFALVLAGLCNFIAPLIFNDTSFYKTPQWFVGVLFLVLIRRKFA

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
38-191 TIR
Toll/interleukin-1 receptor homology (TIR) domain

LQPPQSLPPRPRPQVFVSFRGKELRHGFVSHVVKALRIAGVNVFIDSNEMKGRDLQNLFKRIENSKMALVIFSDRFSESDWCLNELVKIDDCVKEGKLTVIPVFYRVNTDDVKNFKGKFGSCFIETVQRQSPKEEPMAERWVNSVKSISSKTGF

ProfileScan: PS50104
IPR000157
48-188 TIR
Toll/interleukin-1 receptor homology (TIR) domain

PRPQVFVSFRGKELRHGFVSHVVKALRIAGVNVFIDSNEMKGRDLQNLFKRIENSKMALVIFSDRFSESDWCLNELVKIDDCVKEGKLTVIPVFYRVNTDDVKNFKGKFGSCFIETVQRQSPKEEPMAERWVNSVKSISSK

HMMSmart: SM00255
IPR000157
49-188 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RPQVFVSFRGKELRHGFVSHVVKALRIAGVNVFIDSNEMKGRDLQNLFKRIENSKMALVIFSDRFSESDWCLNELVKIDDCVKEGKLTVIPVFYRVNTDDVKNFKGKFGSCFIETVQRQSPKEEPMAERWVNSVKSISSK

Gene3D: G3DSA:3.40.50.10140
51-183 G3DSA:3.40.50.10140

QVFVSFRGKELRHGFVSHVVKALRIAGVNVFIDSNEMKGRDLQNLFKRIENSKMALVIFSDRFSESDWCLNELVKIDDCVKEGKLTVIPVFYRVNTDDVKNFKGKFGSCFIETVQRQSPKEEPMAERWVNSVK

HMMPfam: PF01582
IPR000157
52-180 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFVSFRGKELRHGFVSHVVKALRIAGVNVFIDSNEMKGRDLQNLFKRIENSKMALVIFSDRFSESDWCLNELVKIDDCVKEGKLTVIPVFYRVNTDDVKNFKGKFGSCFIETVQRQSPKEEPMAERWVN

HMMPanther: PTHR23155
59-192 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KELRHGFVSHVVKALRIAGVNVFIDSNEMKGRDLQNLFKRIENSKMALVIFSDRFSESDWCLNELVKIDDCVKEGKLTVIPVFYRVNTDDVKNFKGKFGSCFIETVQRQSPKEEPMAERWVNSVKSISSKTGFT

HMMPanther: PTHR23155:SF66
59-192 PTHR23155:SF66,DISEASE RESISTANCE PROTEIN (TIR-NBS-LRR CLASS)

KELRHGFVSHVVKALRIAGVNVFIDSNEMKGRDLQNLFKRIENSKMALVIFSDRFSESDWCLNELVKIDDCVKEGKLTVIPVFYRVNTDDVKNFKGKFGSCFIETVQRQSPKEEPMAERWVNSVKSISSKTGFT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox