PRGDB00047268 (disease resistance protein RPP1-WsB-like (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein RPP1-WsB-like (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 30692214 (NM_180324)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein RPP1-WsB-like (TIR-NBS-LRR class), putative (AT3G44630) mRNA, complete cds.

DNA Sequence

ATGGGTTCTGCAATGAGCTTGAGCTGTTCCAAGAGGAAAGCAACGAGTCAGGATGTTGATTCCGAATCTTGTAAAAGACGAAAGACATGCTCAACAAACGATGCTGAGAATTGCATATTCATTCCGGATGAGTCATCTTGGAGTTTATGTGCCAACAGAGTCATCACTGTGGCAGCCGTAGCTTTAACAAATTTCAGATTCCAACAAGATAACCAAGAAAGTAATTCTTCTTCTTTATCTCTTCCCTCCCTTGCAACTTCTGTGTCTCGAAACTGGAAACACGATGTCTTCCCGAGCTTCCACGGAGCAGATGTCCGAAGAACCTTTCTTAGTCACATCATGGAATCGTTCAGAAGAAAGGGAATTGACACATTCATTGATAATAATATAGAGAGGAGTAAGTCGATCGGTCCTGAGCTCAAAGAAGCTATCAAAGGATCAAAGATCGCAATCGTTTTGCTCTCAAGAAAATATGCTTCTTCGTCTTGGTGTCTTGATGAGTTGGCCGAGATCATGAAATGCAGGCAAATGGTGGGTCAGATTGTCATGACCATTTTCTATGAAGTGGAGCCAACTGACATAAAGAAACAGACCGGTGAATTTGGAAAAGCCTTCACAAAAACATGTAGAGGTAAACCAAAAGAGCAAGTTGAGAGATGGAGAAAAGCTTTGGAGGATGTGGCAACAATCGCCGGATATCATTCTCACAGCTGGAGGAATGAAGCAGACATGATTGAGAAAATAGCCACTGATGTTTCAAACATGTTAAATAGTTTCACACCATCAAGAGATTTCGACGGGTTAGTAGGGATGAGAGCTCATATGGATATGCTGGAACAATTGTTGCGCTTAGATTTGGATGAAGTAAGGATAATCGGGATTTGGGGACCGCCTGGGATTGGTAAGACAACTATCGCCAGATTTCTGCTTAACCAAGTCTCCGACAGATTCCAACTTAGTGCAATCATGGTCAATATCAAAGGATGCTATCCAAGACCTTGTTTCGATGAGTACAGTGCACAATTGCAACTACAAAACCAAATGTTGTCCCAGATGATCAATCATAAAGATATCATGATTTCTCATTTAGGAGTGGCTCAAGAACGGTTGAGAGACAAGAAAGTGTTTCTTGTTCTCGATGAAGTGGATCAATTAGGACAACTAGATGCCTTGGCGAAAGAAACTCGATGGTTTGGTCCTGGAAGTCGGATTATTATCACAACAGAAGATCTAGGAGTTTTGAAGGCTCATGGGATCAATCATGTTTACAAAGTCGAATATCCATCAAATGACGAGGCTTTTCAAATCTTCTGTATGAATGCCTTTGGTCAGAAACAACCACACGAAGGTTTCGATGAGATTGCTTGGGAAGTTAAGGCTTTAGCTGGTAAACTCCCTTTGGGATTGAAGGTTCTAGGCTCTGCTTTGCGGGGGAAGTCCAAGCCAGAGTGGGAAAGAACACTACCAAGGTTAAGAACTAGCCTCGACGGAAAAATCGGGGGCATTATACAGTTCAGTTACGATGCCTTATGTGACGAAGATAAATATCTATTTCTTTATATAGCCTGCCTTTTTAACGGCGAATCAACAACCAAAGTGAAAGAGCTTCTTGGAAAGTTCTTGGATGTGAGACAAGGCCTTCACGTATTAGCTCAGAAATCTCTCATATCCTTTGATGAAGAAATCTCTTGGAAACAAATTGTTCAAGTTCTTCTTTTAAACAAGTTCTCGCATGTGAGGCATACGAAGAGAAACAAGTCGCAAATAATACGGATGCATACTCTGCTAGAACAATTCGGAAGAGAAACTTCCCGTAAGCAATTCGTTCATCACCGCTATACGAAACATCAGCTTTTGGTTGGTGAAAGGGATATATGTGAAGTGCTCGACGATGATACAACAGATAATAGACGTTTTATAGGGATAAATTTGGATTTATATAAGAATGAGGAAGAATTGAATATAAGTGAGAAAGCACTTGAAAGAATCCATGATTTTCAATTCGTTAAAATCAATTACGTATTTACTCATCAACCTGAGAGAGTGCAGTTAGCACTAGAAGATCTGATTTATCACTCTCCACGAATTAGATCATTGAAATGGTTTCCTTACCAGAATATATGTTTGCCTTCTACTTTTAATCCGGAGTTTCTCGTCGAACTAGATATGCGTTGCAGCAAGCTTCGGAAGCTATGGGAAGGAACTAAACAACTTAGAAATCTCAAGTGGATGGATTTGAGTGATTCTAGAGATTTGAAAGAGCTTCCCTCCTCTATTGAAAAACTCACCAGTCTCCAAATATTAGATCTCCGGGATTGCTCAAGTCTTGTGAAGCTCCCACCATCTATCAATGCCAATAATCTCCAGGGATTGTCTCTAACAAATTGTTCACGTGTTGTGAAGCTCCCCGCTATTGAGAATGTGACTAATCTCCATCAATTGAAGCTCCAAAATTGCTCAAGTCTAATAGAGCTCCCTCTTTCTATTGGAACTGCCAACAATCTTTGGAAATTGGATATCAGAGGATGTTCAAGTCTCGTGAAACTTCCATCCTCTATTGGAGATATGACTAATCTCAAAGAGTTTGATCTATCTAACTGCTCAAATCTGGTGGAGCTTCCTTCTTCTATTGGAAACCTTCAAAAATTGTTTATGTTGAGAATGAGAGGATGCTCAAAGCTAGAAACTCTTCCAACAAACATCAACTTGATATCTCTCCGTATACTTGATCTCACAGATTGCTCGCAGTTGAAAAGTTTTCCCGAGATCTCCACACACATTTCAGAGCTCAGGTTAAAAGGAACTGCAATAAAAGAAGTTCCTTTGTCGATCACGTCGTGGTCTCGTCTTGCTGTATATGAAATGTCATACTTTGAAAGCCTTAAGGAATTCCCGCATGCTCTTGACATCATCACCGACCTACTTTTGGTAAGTGAAGATATACAAGAAGTTCCTCCATGGGTCAAGAGAATGTCTCGTTTACGTGCTCTTAGACTCAACAACTGCAATAGTCTGGTATCACTCCCACAACTTCCAGATTCCCTTGATTACATATATGCAGATAATTGTAAGTCCCTCGAGAGACTGGATTGTTGCTTTAACAATCCAGAGATCCGTCTCTATTTCCCCAAATGCTTCAAACTGAATCAAGAAGCCAGAGATCTCATCATGCACACATCAACTCGTAAATATGCGATGTTACCAAGTATACAAGTGCCTGCCTGCTTCAATCACCGAGCTACTTCTGGGGATTACTTGAAAATCAAGTTGAAGGAGTCGTCTCTTCCTACAACCTTGAGATTTAAGGCTTGTATCATGCTTGTTAAGGTTAATGAAGAAATGAGAGATGATGAGATGTGGCCGAGTGTACTCATTGCCATCAGGGTCAAACAGAATGATCTCAAAGTTCTATGTACAGCAAGCATATATCCAGTTTTAACAGAGCATATATACACATTTGAACTTGAAGTAGAGGAGGTGACTTCCACGGAGCTTGTCTTTGAGTTCACACCATTCCACAAAAGCAATTGGAAGATAGGAGAATGCGGGATACTCCAAAGAGAAACGAGATCATTTTGCCGGAGCTCTTCGCCGGATCTTCCGCCAGAATCTTCTCGTGCGTTCTCTCTCTCTCTCTCTCACTCTCCCTTTCTATCTCTCTGTCTCATGGATTGGTTAATGATTCGATTTCTCCTAATGGGTTTCAGGTGTGTTTCTAGCTAG


Protein sequences

Name Description Sequence
disease resistance protein RPP1-WsB-like (TIR-NBS-LRR class), putative disease resistance protein RPP1-WsB-like (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MGSAMSLSCSKRKATSQDVDSESCKRRKTCSTNDAENCIFIPDESSWSLCANRVITVAAVALTNFRFQQDNQESNSSSLSLPSLATSVSRNWKHDVFPSFHGADVRRTFLSHIMESFRRKGIDTFIDNNIERSKSIGPELKEAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCRQMVGQIVMTIFYEVEPTDIKKQTGEFGKAFTKTCRGKPKEQVERWRKALEDVATIAGYHSHSWRNEADMIEKIATDVSNMLNSFTPSRDFDGLVGMRAHMDMLEQLLRLDLDEVRIIGIWGPPGIGKTTIARFLLNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVEYPSNDEAFQIFCMNAFGQKQPHEGFDEIAWEVKALAGKLPLGLKVLGSALRGKSKPEWERTLPRLRTSLDGKIGGIIQFSYDALCDEDKYLFLYIACLFNGESTTKVKELLGKFLDVRQGLHVLAQKSLISFDEEISWKQIVQVLLLNKFSHVRHTKRNKSQIIRMHTLLEQFGRETSRKQFVHHRYTKHQLLVGERDICEVLDDDTTDNRRFIGINLDLYKNEEELNISEKALERIHDFQFVKINYVFTHQPERVQLALEDLIYHSPRIRSLKWFPYQNICLPSTFNPEFLVELDMRCSKLRKLWEGTKQLRNLKWMDLSDSRDLKELPSSIEKLTSLQILDLRDCSSLVKLPPSINANNLQGLSLTNCSRVVKLPAIENVTNLHQLKLQNCSSLIELPLSIGTANNLWKLDIRGCSSLVKLPSSIGDMTNLKEFDLSNCSNLVELPSSIGNLQKLFMLRMRGCSKLETLPTNINLISLRILDLTDCSQLKSFPEISTHISELRLKGTAIKEVPLSITSWSRLAVYEMSYFESLKEFPHALDIITDLLLVSEDIQEVPPWVKRMSRLRALRLNNCNSLVSLPQLPDSLDYIYADNCKSLERLDCCFNNPEIRLYFPKCFKLNQEARDLIMHTSTRKYAMLPSIQVPACFNHRATSGDYLKIKLKESSLPTTLRFKACIMLVKVNEEMRDDEMWPSVLIAIRVKQNDLKVLCTASIYPVLTEHIYTFELEVEEVTSTELVFEFTPFHKSNWKIGECGILQRETRSFCRSSSPDLPPESSRAFSLSLSHSPFLSLCLMDWLMIRFLLMGFRCVSS

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.40.50.10140
90-228 G3DSA:3.40.50.10140

RNWKHDVFPSFHGADVRRTFLSHIMESFRRKGIDTFIDNNIERSKSIGPELKEAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCRQMVGQIVMTIFYEVEPTDIKKQTGEFGKAFTKTCRGKPKEQVERWRKALEDVA

ProfileScan: PS50104
IPR000157
92-230 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WKHDVFPSFHGADVRRTFLSHIMESFRRKGIDTFIDNNIERSKSIGPELKEAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCRQMVGQIVMTIFYEVEPTDIKKQTGEFGKAFTKTCRGKPKEQVERWRKALEDVATI

HMMSmart: SM00255
IPR000157
93-230 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KHDVFPSFHGADVRRTFLSHIMESFRRKGIDTFIDNNIERSKSIGPELKEAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCRQMVGQIVMTIFYEVEPTDIKKQTGEFGKAFTKTCRGKPKEQVERWRKALEDVATI

HMMPfam: PF01582
IPR000157
96-225 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFHGADVRRTFLSHIMESFRRKGIDTFIDNNIERSKSIGPELKEAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCRQMVGQIVMTIFYEVEPTDIKKQTGEFGKAFTKTCRGKPKEQVERWRKALE

HMMPanther: PTHR23155:SF298
104-1071 PTHR23155:SF298

DVRRTFLSHIMESFRRKGIDTFIDNNIERSKSIGPELKEAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCRQMVGQIVMTIFYEVEPTDIKKQTGEFGKAFTKTCRGKPKEQVERWRKALEDVATIAGYHSHSWRNEADMIEKIATDVSNMLNSFTPSRDFDGLVGMRAHMDMLEQLLRLDLDEVRIIGIWGPPGIGKTTIARFLLNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVEYPSNDEAFQIFCMNAFGQKQPHEGFDEIAWEVKALAGKLPLGLKVLGSALRGKSKPEWERTLPRLRTSLDGKIGGIIQFSYDALCDEDKYLFLYIACLFNGESTTKVKELLGKFLDVRQGLHVLAQKSLISFDEEISWKQIVQVLLLNKFSHVRHTKRNKSQIIRMHTLLEQFGRETSRKQFVHHRYTKHQLLVGERDICEVLDDDTTDNRRFIGINLDLYKNEEELNISEKALERIHDFQFVKINYVFTHQPERVQLALEDLIYHSPRIRSLKWFPYQNICLPSTFNPEFLVELDMRCSKLRKLWEGTKQLRNLKWMDLSDSRDLKELPSSIEKLTSLQILDLRDCSSLVKLPPSINANNLQGLSLTNCSRVVKLPAIENVTNLHQLKLQNCSSLIELPLSIGTANNLWKLDIRGCSSLVKLPSSIGDMTNLKEFDLSNCSNLVELPSSIGNLQKLFMLRMRGCSKLETLPTNINLISLRILDLTDCSQLKSFPEISTHISELRLKGTAIKEVPLSITSWSRLAVYEMSYFESLKEFPHALDIITDLLLVSEDIQEVPPWVKRMSRLRALRLNNCNSLVSLPQLPDSLDYIYADNCKSLERLDCCFNNPEIRLYFPKCFKLNQEARDLIMHTSTRKYAMLPSIQ

HMMPanther: PTHR23155
104-1071 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DVRRTFLSHIMESFRRKGIDTFIDNNIERSKSIGPELKEAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCRQMVGQIVMTIFYEVEPTDIKKQTGEFGKAFTKTCRGKPKEQVERWRKALEDVATIAGYHSHSWRNEADMIEKIATDVSNMLNSFTPSRDFDGLVGMRAHMDMLEQLLRLDLDEVRIIGIWGPPGIGKTTIARFLLNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVEYPSNDEAFQIFCMNAFGQKQPHEGFDEIAWEVKALAGKLPLGLKVLGSALRGKSKPEWERTLPRLRTSLDGKIGGIIQFSYDALCDEDKYLFLYIACLFNGESTTKVKELLGKFLDVRQGLHVLAQKSLISFDEEISWKQIVQVLLLNKFSHVRHTKRNKSQIIRMHTLLEQFGRETSRKQFVHHRYTKHQLLVGERDICEVLDDDTTDNRRFIGINLDLYKNEEELNISEKALERIHDFQFVKINYVFTHQPERVQLALEDLIYHSPRIRSLKWFPYQNICLPSTFNPEFLVELDMRCSKLRKLWEGTKQLRNLKWMDLSDSRDLKELPSSIEKLTSLQILDLRDCSSLVKLPPSINANNLQGLSLTNCSRVVKLPAIENVTNLHQLKLQNCSSLIELPLSIGTANNLWKLDIRGCSSLVKLPSSIGDMTNLKEFDLSNCSNLVELPSSIGNLQKLFMLRMRGCSKLETLPTNINLISLRILDLTDCSQLKSFPEISTHISELRLKGTAIKEVPLSITSWSRLAVYEMSYFESLKEFPHALDIITDLLLVSEDIQEVPPWVKRMSRLRALRLNNCNSLVSLPQLPDSLDYIYADNCKSLERLDCCFNNPEIRLYFPKCFKLNQEARDLIMHTSTRKYAMLPSIQ

superfamily: SSF52540
147-519 SSF52540

SKIAIVLLSRKYASSSWCLDELAEIMKCRQMVGQIVMTIFYEVEPTDIKKQTGEFGKAFTKTCRGKPKEQVERWRKALEDVATIAGYHSHSWRNEADMIEKIATDVSNMLNSFTPSRDFDGLVGMRAHMDMLEQLLRLDLDEVRIIGIWGPPGIGKTTIARFLLNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVEYPSNDEAFQIFCMNAFGQKQPHEGFDEIAWEVKALAGKLPLGLKVLGSALRGKSKPEWERTLPRLRTSLDGKIGGIIQFSYDALCDEDKYLFL

Gene3D: G3DSA:3.40.50.300
255-415 G3DSA:3.40.50.300

MLNSFTPSRDFDGLVGMRAHMDMLEQLLRLDLDEVRIIGIWGPPGIGKTTIARFLLNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLK

HMMPfam: PF00931
IPR002182
276-531 NB-ARC,NBS
NB-ARC

DMLEQLLRLDLDEVRIIGIWGPPGIGKTTIARFLLNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVEYPSNDEAFQIFCMNAFGQKQPHEGFDEIAWEVKALAGKLPLGLKVLGSALRGKSKPEWERTLPRLRTSLDGKIGGIIQFSYDALCDEDKYLFLYIACLFNGESTT

HMMSmart: SM00382
IPR003593
288-426 AAA,NBS
AAA+ ATPase domain

EVRIIGIWGPPGIGKTTIARFLLNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVE

FPrintScan: PR00364
IPR000767
291-306 DISEASERSIST
Disease resistance protein

IIGIWGPPGIGKTTIA

FPrintScan: PR00364
IPR000767
369-383 DISEASERSIST
Disease resistance protein

RLRDKKVFLVLDEVD

FPrintScan: PR00364
IPR000767
462-476 DISEASERSIST
Disease resistance protein

AGKLPLGLKVLGSAL

superfamily: SSF52058
611-1012 SSF52058,LRR

HRYTKHQLLVGERDICEVLDDDTTDNRRFIGINLDLYKNEEELNISEKALERIHDFQFVKINYVFTHQPERVQLALEDLIYHSPRIRSLKWFPYQNICLPSTFNPEFLVELDMRCSKLRKLWEGTKQLRNLKWMDLSDSRDLKELPSSIEKLTSLQILDLRDCSSLVKLPPSINANNLQGLSLTNCSRVVKLPAIENVTNLHQLKLQNCSSLIELPLSIGTANNLWKLDIRGCSSLVKLPSSIGDMTNLKEFDLSNCSNLVELPSSIGNLQKLFMLRMRGCSKLETLPTNINLISLRILDLTDCSQLKSFPEISTHISELRLKGTAIKEVPLSITSWSRLAVYEMSYFESLKEFPHALDIITDLLLVSEDIQEVPPWVKRMSRLRALRLNNCNSLVSLPQLP

Gene3D: G3DSA:3.80.10.10
650-1011 G3DSA:3.80.10.10

EEELNISEKALERIHDFQFVKINYVFTHQPERVQLALEDLIYHSPRIRSLKWFPYQNICLPSTFNPEFLVELDMRCSKLRKLWEGTKQLRNLKWMDLSDSRDLKELPSSIEKLTSLQILDLRDCSSLVKLPPSINANNLQGLSLTNCSRVVKLPAIENVTNLHQLKLQNCSSLIELPLSIGTANNLWKLDIRGCSSLVKLPSSIGDMTNLKEFDLSNCSNLVELPSSIGNLQKLFMLRMRGCSKLETLPTNINLISLRILDLTDCSQLKSFPEISTHISELRLKGTAIKEVPLSITSWSRLAVYEMSYFESLKEFPHALDIITDLLLVSEDIQEVPPWVKRMSRLRALRLNNCNSLVSLPQL

HMMPfam: PF07725
IPR011713
717-736 LRR_3
Leucine-rich repeat 3

FLVELDMRCSKLRKLWEGTK

FPrintScan: PR00364
IPR000767
760-776 DISEASERSIST
Disease resistance protein

EKLTSLQILDLRDCSSL

HMMPfam: PF00560
IPR001611
764-783 LRR_1
Leucine-rich repeat

SLQILDLRDCSSLVKLPPSI

HMMPfam: PF00560
IPR001611
858-880 LRR_1
Leucine-rich repeat

NLKEFDLSNCSNLVELPSSIGNL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox