PRGDB00047271 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18414777 (NM_117795)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT4G16920) mRNA, complete cds.

DNA Sequence

ATGGCGGCAGCTTCTTCTTCTGGCAGCGACATTTTTCCAAGCTTCAGTGGGGAAGATGTTCGCAAGAATTTCCTCAGCCATCTTCTTAAGCAGCTCAATCGCAGATCAATCAATACATTCATGGATCACGTCATCGAGAGAAGCTGCATAATCGCCGATGCGCTTATATCGGCGATTAGAGAAGCGAGGATCTCAATTGTCATCTTCTCTAAGAACTATGCTGCTTCCACGTGGTGCTTGAATGAATTGGTTGAAATCGACAATTGCTCTAAATATTTTGGACAAAAGGTGATACCGGTTTTCTACGACGTTGATCCTTCTCATGTTAGAAAACAGATCGGTGAATTTGGAAAGGTCTTTAAAAAGACATGCGAGGACAAACCAGCAGATCAGAAACAAAGATGGGTTAAAGCTCTCACAGATATATCAAATATTGCCGGGGAGGATCTTCGGAACGGGCCTAATGATGCGCATATGGTTGAAAAGATAGCCAATGATGTTTCGAATAAACTTTTTCATCCGCCAAAGGGTTTTGGTGACTTAGTCGGAATTGAAGATCATATAGAGGCAATAAAATCAATACTGTGCTTGGAATCCAAAGAAGCTAAAATAATGGTCGGGATTTGGGGACAGTCAGGGATTGGTAAGAGTACCATAGGAAGAGCTCTTTTCAGTCAACTCTCTAGCCAATTCCCCCTTCGCGCTTTCGTAACTTACAAAAGCACCAGCGGTAGTGACGTCTCTGGCATGAAGTTGAGTTGGCAAAAAGAACTTCTCTCGGAAATCTTAGGTCAAAAGGACATAAAGATAGATCATTTTGGTGTGGTGGAGCAAAGATTAAAGCACAAAAAAGTTCTTATCCTTCTTGATGATGTGGATAATCTAGAGTTTCTTAAGACCTTAGTGGGAAAAGCTGAATGGTTTGGATCTGGAAGCAGAATAATTGTGATCACTCAAGATAGGCAACTTCTCAAGGCTCATGAGATTGACCTTGTATATGAGGTGAAGCTGCCATCTCAAGGTCTTGCTCTTCAGATGATATCCCAATATGCTTTTGGGAAAGACTCTCCACCTGATGATTTTAAGGCACTAGCATTTGAAGTTGCCGAGCTTGCTGGTAGTCTTCCTTTGGGTCTCAGTGTCTTGGGTTCATCTCTAAAAGGAAGGGACAAAGATGAGTGGGTGAAGATGATGCCTAGGCTTCGAAATGACTCAGATGATAAAATTGAGGAAACACTAAGAGTCTGCTACGATAGGTTAAATAAAAAAAATAGAGAGTTATTTAAGTGCATTGCATGTTTCTTCAATGGTTTTAAAGTCAGTAACGTCAAAGAATTACTTGAAGATGATGTTGGGCTTACAATGTTGGTTGAGAAGTCCCTCATACGTATTACACCGGATGGAGATATAGAGATGCACAATTTGCTAGAGAAATTGGGTAGAGAAATTGATCGTGCAAAGTCCAAGGGTAATCCTGGAAAACGTCAATTTCTGACAAATTTTGAGGATATTCAAGAAGTATTGGCCGAGAAAACTGGGACAGAAATTCTTCTTGGAATACGTTTGCCACACCCGGGATATCTTACGACAAGGTCGTTCTTAATAGATGAAAAATTATTCAAAGGCATGCGTAATCTCCAATATCTAGAAATTGGTTATTGGTCAGATGGGGATCTACCTCAGAGCCTCGTTTATTTGCCCCTTAAACTCAGATTGCTAGAATGGGTTTATTGTCCGTTGAAGTCTTTGCCATCTACTTTTAGGGCGGAGTATCTAGTTAAACTCATAATGAAGAATAGTAAGCTTGAGAAACTGTGGGAAGGAACTCTGCCCCTTGGAAGTCTCAAGAAGATGAATTTGTGGTATTCCAAATATTTTAAAGAAATTCCAGATCTTTCTTTAGCCATAAACCTCGAGGAATTAAATCTTTCTGAATGCGAATCTTTGGTGACACTTCCTTCCTCGATTCAGAATGCCATTAAACTGAGGACGTTATATTGTTCGGGGGTGCTATTAATAGATTTAAAATCATTAGAAGGCATGTGTAATCTCGAATATCTATCAGTTGATTGCTCACGTATGGAAGGCACTCAGGGCATCGTTTATTTCCCTAGTAAACTCAGATTGCTATTGTGGAATAATTGTCCATTGAAGCGTTTGCATTCTAATTTTAAGGTTGAGTATCTGGTTAAACTCAGAATGGAGAATAGTGACCTTGAGAAGCTGTGGGATGGAACTCAGCCACTTGGAAGACTCAAGCAGATGTTTCTGCGTGGTTCCAAATATTTGAAAGAGATTCCAGATCTTTCTTTAGCCATAAACCTCGAGGAAGTAGATATTTGTAAATGCGAATCCTTGGTGACATTTCCTTCCTCGATGCAGAATGCCATTAAACTTATCTATTTAGATATTAGTGATTGCAAAAAGCTAGAGAGTTTTCCAACCGATCTCAACTTGGAATCTCTCGAGTACCTCAATCTCACTGGATGCCCGAATTTGAGAAATTTCCCAGCAATCAAAATGGGATGTTCAGACGTTGACTTTCCGGAAGGGAGAAATGAGATCGTGGTAGAAGATTGTTTCTGGAACAAGAATCTCCCTGCTGGACTAGATTATCTCGACTGCCTTATGAGATGTATGCCTTGTGAATTTCGCCCAGAATATCTCGTTTTTCTCAATGTGAGGTGCTACAAGCATGAGAAGCTATGGGAAGGCATCCAGTCGCTTGGAAGTCTCGAAGAGATGGATCTGTCAGAATCTGAAAACCTGACAGAAATTCCAGATCTTTCAAAGGCCACCAATCTGAAGCATTTATATCTCAACAACTGCAAAAGTTTGGTGACACTTCCTTCTACTATTGGGAATCTCCAAAAATTGGTGAGGTTGGAAATGAAAGAATGCACAGGGCTGGAGGTTCTTCCAACCGATGTCAACTTGTCATCTCTCGAAACCCTCGATCTCAGTGGTTGCTCAAGTTTGAGAACTTTTCCTCTGATTTCAAAGAGTATCAAATGGCTCTATCTGGAAAACACCGCCATTGAAGAAATTCTAGATCTTTCAAAGGCCACCAAGCTCGAGTCTTTGATACTCAACAACTGCAAAAGTTTGGTGACACTTCCTTCTACAATTGGGAATCTTCAAAATTTGAGACGTTTGTACATGAAAAGATGCACAGGGCTGGAGGTTCTTCCAACCGATGTCAACTTGTCATCTCTGGGTATCCTCGATCTCAGTGGTTGCTCAAGTTTGAGAACTTTTCCTCTGATTTCAACTAATATTGTATGGCTCTATCTGGAAAACACCGCCATTGGAGAAGTTCCCTGCTGCATTGAGGATTTCACGAGGCTCCGTGTACTACTGATGTATTGTTGCCAGAGGTTGAAAAACATCTCCCCAAACATTTTCAGACTGAGAAGTCTAATGTTCGCCGACTTTACAGACTGTAGAGGTGTCATCAAGGCGTTGAGTGATGCAACTGTGGTAGCGACAATGGAAGATCACGTTTCTTGTGTACCATTATCTGAAAACATTGAATATACATGTGAACGTTTCTGGGATGCGTTGTATGATGATGATTATAAGAACTACTTTAAATTTTGTTGCTCCAATAGGATCAAAGAATGCGGTGTACGACTCTTGTATGTCTATCAAGAAACAGAGTACAACCAACAGACTACGAGAAGCGAGAAGCGGATGGGGATGACATCGGGGACATCTGAAGAATATATCAACTTACCCTATGGCCAAATTGTAGCGGACTCAGGATTGGCCGCTCTAAATATGGAGCTTTCGTTAGGGCAGGGAGAAGCATCATCATCAACATCTCTAGAGGGGGAAGCTTTGTGTGTTGATTACATGATAACTGAAGAACAAGATGAAGAAATTCCTATCTTGTCTACTGATTCTGGTAACTGA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MAAASSSGSDIFPSFSGEDVRKNFLSHLLKQLNRRSINTFMDHVIERSCIIADALISAIREARISIVIFSKNYAASTWCLNELVEIDNCSKYFGQKVIPVFYDVDPSHVRKQIGEFGKVFKKTCEDKPADQKQRWVKALTDISNIAGEDLRNGPNDAHMVEKIANDVSNKLFHPPKGFGDLVGIEDHIEAIKSILCLESKEAKIMVGIWGQSGIGKSTIGRALFSQLSSQFPLRAFVTYKSTSGSDVSGMKLSWQKELLSEILGQKDIKIDHFGVVEQRLKHKKVLILLDDVDNLEFLKTLVGKAEWFGSGSRIIVITQDRQLLKAHEIDLVYEVKLPSQGLALQMISQYAFGKDSPPDDFKALAFEVAELAGSLPLGLSVLGSSLKGRDKDEWVKMMPRLRNDSDDKIEETLRVCYDRLNKKNRELFKCIACFFNGFKVSNVKELLEDDVGLTMLVEKSLIRITPDGDIEMHNLLEKLGREIDRAKSKGNPGKRQFLTNFEDIQEVLAEKTGTEILLGIRLPHPGYLTTRSFLIDEKLFKGMRNLQYLEIGYWSDGDLPQSLVYLPLKLRLLEWVYCPLKSLPSTFRAEYLVKLIMKNSKLEKLWEGTLPLGSLKKMNLWYSKYFKEIPDLSLAINLEELNLSECESLVTLPSSIQNAIKLRTLYCSGVLLIDLKSLEGMCNLEYLSVDCSRMEGTQGIVYFPSKLRLLLWNNCPLKRLHSNFKVEYLVKLRMENSDLEKLWDGTQPLGRLKQMFLRGSKYLKEIPDLSLAINLEEVDICKCESLVTFPSSMQNAIKLIYLDISDCKKLESFPTDLNLESLEYLNLTGCPNLRNFPAIKMGCSDVDFPEGRNEIVVEDCFWNKNLPAGLDYLDCLMRCMPCEFRPEYLVFLNVRCYKHEKLWEGIQSLGSLEEMDLSESENLTEIPDLSKATNLKHLYLNNCKSLVTLPSTIGNLQKLVRLEMKECTGLEVLPTDVNLSSLETLDLSGCSSLRTFPLISKSIKWLYLENTAIEEILDLSKATKLESLILNNCKSLVTLPSTIGNLQNLRRLYMKRCTGLEVLPTDVNLSSLGILDLSGCSSLRTFPLISTNIVWLYLENTAIGEVPCCIEDFTRLRVLLMYCCQRLKNISPNIFRLRSLMFADFTDCRGVIKALSDATVVATMEDHVSCVPLSENIEYTCERFWDALYDDDYKNYFKFCCSNRIKECGVRLLYVYQETEYNQQTTRSEKRMGMTSGTSEEYINLPYGQIVADSGLAALNMELSLGQGEASSSTSLEGEALCVDYMITEEQDEEIPILSTDSGN

Domains

Domain Start-End Description Sequence

HMMSmart: SM00255
IPR000157
8-145 TIR
Toll/interleukin-1 receptor homology (TIR) domain

GSDIFPSFSGEDVRKNFLSHLLKQLNRRSINTFMDHVIERSCIIADALISAIREARISIVIFSKNYAASTWCLNELVEIDNCSKYFGQKVIPVFYDVDPSHVRKQIGEFGKVFKKTCEDKPADQKQRWVKALTDISNI

superfamily: SSF52200
IPR000157
10-148 TIR
Toll/interleukin-1 receptor homology (TIR) domain

DIFPSFSGEDVRKNFLSHLLKQLNRRSINTFMDHVIERSCIIADALISAIREARISIVIFSKNYAASTWCLNELVEIDNCSKYFGQKVIPVFYDVDPSHVRKQIGEFGKVFKKTCEDKPADQKQRWVKALTDISNIAGE

Gene3D: G3DSA:3.40.50.10140
10-139 G3DSA:3.40.50.10140

DIFPSFSGEDVRKNFLSHLLKQLNRRSINTFMDHVIERSCIIADALISAIREARISIVIFSKNYAASTWCLNELVEIDNCSKYFGQKVIPVFYDVDPSHVRKQIGEFGKVFKKTCEDKPADQKQRWVKAL

ProfileScan: PS50104
IPR000157
10-145 TIR
Toll/interleukin-1 receptor homology (TIR) domain

DIFPSFSGEDVRKNFLSHLLKQLNRRSINTFMDHVIERSCIIADALISAIREARISIVIFSKNYAASTWCLNELVEIDNCSKYFGQKVIPVFYDVDPSHVRKQIGEFGKVFKKTCEDKPADQKQRWVKALTDISNI

HMMPfam: PF01582
IPR000157
12-140 TIR
Toll/interleukin-1 receptor homology (TIR) domain

FPSFSGEDVRKNFLSHLLKQLNRRSINTFMDHVIERSCIIADALISAIREARISIVIFSKNYAASTWCLNELVEIDNCSKYFGQKVIPVFYDVDPSHVRKQIGEFGKVFKKTCEDKPADQKQRWVKALT

HMMPanther: PTHR11017
30-1253 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KQLNRRSINTFMDHVIERSCIIADALISAIREARISIVIFSKNYAASTWCLNELVEIDNCSKYFGQKVIPVFYDVDPSHVRKQIGEFGKVFKKTCEDKPADQKQRWVKALTDISNIAGEDLRNGPNDAHMVEKIANDVSNKLFHPPKGFGDLVGIEDHIEAIKSILCLESKEAKIMVGIWGQSGIGKSTIGRALFSQLSSQFPLRAFVTYKSTSGSDVSGMKLSWQKELLSEILGQKDIKIDHFGVVEQRLKHKKVLILLDDVDNLEFLKTLVGKAEWFGSGSRIIVITQDRQLLKAHEIDLVYEVKLPSQGLALQMISQYAFGKDSPPDDFKALAFEVAELAGSLPLGLSVLGSSLKGRDKDEWVKMMPRLRNDSDDKIEETLRVCYDRLNKKNRELFKCIACFFNGFKVSNVKELLEDDVGLTMLVEKSLIRITPDGDIEMHNLLEKLGREIDRAKSKGNPGKRQFLTNFEDIQEVLAEKTGTEILLGIRLPHPGYLTTRSFLIDEKLFKGMRNLQYLEIGYWSDGDLPQSLVYLPLKLRLLEWVYCPLKSLPSTFRAEYLVKLIMKNSKLEKLWEGTLPLGSLKKMNLWYSKYFKEIPDLSLAINLEELNLSECESLVTLPSSIQNAIKLRTLYCSGVLLIDLKSLEGMCNLEYLSVDCSRMEGTQGIVYFPSKLRLLLWNNCPLKRLHSNFKVEYLVKLRMENSDLEKLWDGTQPLGRLKQMFLRGSKYLKEIPDLSLAINLEEVDICKCESLVTFPSSMQNAIKLIYLDISDCKKLESFPTDLNLESLEYLNLTGCPNLRNFPAIKMGCSDVDFPEGRNEIVVEDCFWNKNLPAGLDYLDCLMRCMPCEFRPEYLVFLNVRCYKHEKLWEGIQSLGSLEEMDLSESENLTEIPDLSKATNLKHLYLNNCKSLVTLPSTIGNLQKLVRLEMKECTGLEVLPTDVNLSSLETLDLSGCSSLRTFPLISKSIKWLYLENTAIEEILDLSKATKLESLILNNCKSLVTLPSTIGNLQNLRRLYMKRCTGLEVLPTDVNLSSLGILDLSGCSSLRTFPLISTNIVWLYLENTAIGEVPCCIEDFTRLRVLLMYCCQRLKNISPNIFRLRSLMFADFTDCRGVIKALSDATVVATMEDHVSCVPLSENIEYTCERFWDALYDDDYKNYFKFCCSNRIKECGVRLLYVYQETEYNQQTTRSEKRMGMTSGTSEEYINLPYGQIVAD

HMMPanther: PTHR11017:SF20
30-1253 PTHR11017:SF20,SUBFAMILY NOT NAMED

KQLNRRSINTFMDHVIERSCIIADALISAIREARISIVIFSKNYAASTWCLNELVEIDNCSKYFGQKVIPVFYDVDPSHVRKQIGEFGKVFKKTCEDKPADQKQRWVKALTDISNIAGEDLRNGPNDAHMVEKIANDVSNKLFHPPKGFGDLVGIEDHIEAIKSILCLESKEAKIMVGIWGQSGIGKSTIGRALFSQLSSQFPLRAFVTYKSTSGSDVSGMKLSWQKELLSEILGQKDIKIDHFGVVEQRLKHKKVLILLDDVDNLEFLKTLVGKAEWFGSGSRIIVITQDRQLLKAHEIDLVYEVKLPSQGLALQMISQYAFGKDSPPDDFKALAFEVAELAGSLPLGLSVLGSSLKGRDKDEWVKMMPRLRNDSDDKIEETLRVCYDRLNKKNRELFKCIACFFNGFKVSNVKELLEDDVGLTMLVEKSLIRITPDGDIEMHNLLEKLGREIDRAKSKGNPGKRQFLTNFEDIQEVLAEKTGTEILLGIRLPHPGYLTTRSFLIDEKLFKGMRNLQYLEIGYWSDGDLPQSLVYLPLKLRLLEWVYCPLKSLPSTFRAEYLVKLIMKNSKLEKLWEGTLPLGSLKKMNLWYSKYFKEIPDLSLAINLEELNLSECESLVTLPSSIQNAIKLRTLYCSGVLLIDLKSLEGMCNLEYLSVDCSRMEGTQGIVYFPSKLRLLLWNNCPLKRLHSNFKVEYLVKLRMENSDLEKLWDGTQPLGRLKQMFLRGSKYLKEIPDLSLAINLEEVDICKCESLVTFPSSMQNAIKLIYLDISDCKKLESFPTDLNLESLEYLNLTGCPNLRNFPAIKMGCSDVDFPEGRNEIVVEDCFWNKNLPAGLDYLDCLMRCMPCEFRPEYLVFLNVRCYKHEKLWEGIQSLGSLEEMDLSESENLTEIPDLSKATNLKHLYLNNCKSLVTLPSTIGNLQKLVRLEMKECTGLEVLPTDVNLSSLETLDLSGCSSLRTFPLISKSIKWLYLENTAIEEILDLSKATKLESLILNNCKSLVTLPSTIGNLQNLRRLYMKRCTGLEVLPTDVNLSSLGILDLSGCSSLRTFPLISTNIVWLYLENTAIGEVPCCIEDFTRLRVLLMYCCQRLKNISPNIFRLRSLMFADFTDCRGVIKALSDATVVATMEDHVSCVPLSENIEYTCERFWDALYDDDYKNYFKFCCSNRIKECGVRLLYVYQETEYNQQTTRSEKRMGMTSGTSEEYINLPYGQIVAD

superfamily: SSF52540
164-409 SSF52540

ANDVSNKLFHPPKGFGDLVGIEDHIEAIKSILCLESKEAKIMVGIWGQSGIGKSTIGRALFSQLSSQFPLRAFVTYKSTSGSDVSGMKLSWQKELLSEILGQKDIKIDHFGVVEQRLKHKKVLILLDDVDNLEFLKTLVGKAEWFGSGSRIIVITQDRQLLKAHEIDLVYEVKLPSQGLALQMISQYAFGKDSPPDDFKALAFEVAELAGSLPLGLSVLGSSLKGRDKDEWVKMMPRLRNDSDDKI

Gene3D: G3DSA:3.40.50.300
174-324 G3DSA:3.40.50.300

PPKGFGDLVGIEDHIEAIKSILCLESKEAKIMVGIWGQSGIGKSTIGRALFSQLSSQFPLRAFVTYKSTSGSDVSGMKLSWQKELLSEILGQKDIKIDHFGVVEQRLKHKKVLILLDDVDNLEFLKTLVGKAEWFGSGSRIIVITQDRQLL

HMMPfam: PF00931
IPR002182
185-442 NB-ARC,NBS
NB-ARC

EDHIEAIKSILCLESKEAKIMVGIWGQSGIGKSTIGRALFSQLSSQFPLRAFVTYKSTSGSDVSGMKLSWQKELLSEILGQKDIKIDHFGVVEQRLKHKKVLILLDDVDNLEFLKTLVGKAEWFGSGSRIIVITQDRQLLKAHEIDLVYEVKLPSQGLALQMISQYAFGKDSPPDDFKALAFEVAELAGSLPLGLSVLGSSLKGRDKDEWVKMMPRLRNDSDDKIEETLRVCYDRLNKKNRELFKCIACFFNGFKVSN

HMMSmart: SM00382
IPR003593
202-339 AAA,NBS
AAA+ ATPase domain

AKIMVGIWGQSGIGKSTIGRALFSQLSSQFPLRAFVTYKSTSGSDVSGMKLSWQKELLSEILGQKDIKIDHFGVVEQRLKHKKVLILLDDVDNLEFLKTLVGKAEWFGSGSRIIVITQDRQLLKAHEIDLVYEVKLPS

FPrintScan: PR00364
IPR000767
205-220 DISEASERSIST
Disease resistance protein

MVGIWGQSGIGKSTIG

FPrintScan: PR00364
IPR000767
279-293 DISEASERSIST
Disease resistance protein

RLKHKKVLILLDDVD

FPrintScan: PR00364
IPR000767
372-386 DISEASERSIST
Disease resistance protein

AGSLPLGLSVLGSSL

superfamily: SSF46785
407-509 SSF46785

DKIEETLRVCYDRLNKKNRELFKCIACFFNGFKVSNVKELLEDDVGLTMLVEKSLIRITPDGDIEMHNLLEKLGREIDRAKSKGNPGKRQFLTNFEDIQEVLA

superfamily: SSF52058
471-837 SSF52058,LRR

EMHNLLEKLGREIDRAKSKGNPGKRQFLTNFEDIQEVLAEKTGTEILLGIRLPHPGYLTTRSFLIDEKLFKGMRNLQYLEIGYWSDGDLPQSLVYLPLKLRLLEWVYCPLKSLPSTFRAEYLVKLIMKNSKLEKLWEGTLPLGSLKKMNLWYSKYFKEIPDLSLAINLEELNLSECESLVTLPSSIQNAIKLRTLYCSGVLLIDLKSLEGMCNLEYLSVDCSRMEGTQGIVYFPSKLRLLLWNNCPLKRLHSNFKVEYLVKLRMENSDLEKLWDGTQPLGRLKQMFLRGSKYLKEIPDLSLAINLEEVDICKCESLVTFPSSMQNAIKLIYLDISDCKKLESFPTDLNLESLEYLNLTGCPNLRNFP

Gene3D: G3DSA:3.80.10.10
536-684 G3DSA:3.80.10.10

DEKLFKGMRNLQYLEIGYWSDGDLPQSLVYLPLKLRLLEWVYCPLKSLPSTFRAEYLVKLIMKNSKLEKLWEGTLPLGSLKKMNLWYSKYFKEIPDLSLAINLEELNLSECESLVTLPSSIQNAIKLRTLYCSGVLLIDLKSLEGMCNL

HMMPfam: PF07725
IPR011713
591-609 LRR_3
Leucine-rich repeat 3

YLVKLIMKNSKLEKLWEGT

HMMPfam: PF00560
IPR001611
637-658 LRR_1
Leucine-rich repeat

NLEELNLSECESLVTLPSSIQN

Gene3D: G3DSA:3.80.10.10
685-838 G3DSA:3.80.10.10

EYLSVDCSRMEGTQGIVYFPSKLRLLLWNNCPLKRLHSNFKVEYLVKLRMENSDLEKLWDGTQPLGRLKQMFLRGSKYLKEIPDLSLAINLEEVDICKCESLVTFPSSMQNAIKLIYLDISDCKKLESFPTDLNLESLEYLNLTGCPNLRNFPA

HMMPfam: PF07725
IPR011713
728-747 LRR_3
Leucine-rich repeat 3

YLVKLRMENSDLEKLWDGTQ

HMMPfam: PF00560
IPR001611
821-838 LRR_1
Leucine-rich repeat

SLEYLNLTGCPNLRNFPA

superfamily: SSF52058
844-1196 SSF52058,LRR

SDVDFPEGRNEIVVEDCFWNKNLPAGLDYLDCLMRCMPCEFRPEYLVFLNVRCYKHEKLWEGIQSLGSLEEMDLSESENLTEIPDLSKATNLKHLYLNNCKSLVTLPSTIGNLQKLVRLEMKECTGLEVLPTDVNLSSLETLDLSGCSSLRTFPLISKSIKWLYLENTAIEEILDLSKATKLESLILNNCKSLVTLPSTIGNLQNLRRLYMKRCTGLEVLPTDVNLSSLGILDLSGCSSLRTFPLISTNIVWLYLENTAIGEVPCCIEDFTRLRVLLMYCCQRLKNISPNIFRLRSLMFADFTDCRGVIKALSDATVVATMEDHVSCVPLSENIEYTCERFWDALYDDDYKNY

Gene3D: G3DSA:3.80.10.10
868-1150 G3DSA:3.80.10.10

AGLDYLDCLMRCMPCEFRPEYLVFLNVRCYKHEKLWEGIQSLGSLEEMDLSESENLTEIPDLSKATNLKHLYLNNCKSLVTLPSTIGNLQKLVRLEMKECTGLEVLPTDVNLSSLETLDLSGCSSLRTFPLISKSIKWLYLENTAIEEILDLSKATKLESLILNNCKSLVTLPSTIGNLQNLRRLYMKRCTGLEVLPTDVNLSSLGILDLSGCSSLRTFPLISTNIVWLYLENTAIGEVPCCIEDFTRLRVLLMYCCQRLKNISPNIFRLRSLMFADFTDCRG

HMMPfam: PF07725
IPR011713
888-907 LRR_3
Leucine-rich repeat 3

YLVFLNVRCYKHEKLWEGIQ

HMMPfam: PF00560
IPR001611
934-956 LRR_1
Leucine-rich repeat

NLKHLYLNNCKSLVTLPSTIGNL

FPrintScan: PR00364
IPR000767
977-993 DISEASERSIST
Disease resistance protein

VNLSSLETLDLSGCSSL

HMMPfam: PF00560
IPR001611
981-998 LRR_1
Leucine-rich repeat

SLETLDLSGCSSLRTFPL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox