PRGDB00047275 (disease resistance protein (TIR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18405996 (NM_104560)
Gene Class TNL
Domain Type TIR, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR class), putative (AT1G57630) mRNA, complete cds.

DNA Sequence

ATGGCTTCTTCTTCTTCTTTATCTCTTTCATTTCCTTCATCTTCTTTGTCTCGAACCTGGGATTACGATGTTTTTCCGAGCTTTCACGGGGAAGATGTACGCAAAGCCTTTCTCAGCCAGATTCTCAAGAAGGAGTTTGGAAGAAAAGCAATCAACTTTTTTGTTGATCACGAGATGGAGAGAGGAGAGTTCATCGGTCCTGTACTCAAACAGGCGATCAAAGGATCTAAGATTGCTCTTGTCTTGCTCTCCAAGAATTACGCTTCTTCGTGGTGTTGTCTTGACGAATTGGTGGAGATCATGAAGAAAGAGTCGGGTCAAACGGTGATTACCATTTTCTATGAAGTTGATCCAAATGAAGTAAAGAAGCAGACCGGAGATTTTGGGAAGGCCTTCAAAGAAACTTGTCAAGGTAAAACTGAGGAAAAGGTTCAGACATGGAGGAAAGCTTTGGAGGGTGTGGGTTTGGCCACAATCGCAGGTTTTCATTCAAGCAACTGGTTCGTGTTCTTTATTTAA


Protein sequences

Name Description Sequence
disease resistance protein (TIR class), putative disease resistance protein (TIR class), putative [Arabidopsis thaliana].

MASSSSLSLSFPSSSLSRTWDYDVFPSFHGEDVRKAFLSQILKKEFGRKAINFFVDHEMERGEFIGPVLKQAIKGSKIALVLLSKNYASSWCCLDELVEIMKKESGQTVITIFYEVDPNEVKKQTGDFGKAFKETCQGKTEEKVQTWRKALEGVGLATIAGFHSSNWFVFFI

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
10-155 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SFPSSSLSRTWDYDVFPSFHGEDVRKAFLSQILKKEFGRKAINFFVDHEMERGEFIGPVLKQAIKGSKIALVLLSKNYASSWCCLDELVEIMKKESGQTVITIFYEVDPNEVKKQTGDFGKAFKETCQGKTEEKVQTWRKALEGVG

Gene3D: G3DSA:3.40.50.10140
18-152 G3DSA:3.40.50.10140

RTWDYDVFPSFHGEDVRKAFLSQILKKEFGRKAINFFVDHEMERGEFIGPVLKQAIKGSKIALVLLSKNYASSWCCLDELVEIMKKESGQTVITIFYEVDPNEVKKQTGDFGKAFKETCQGKTEEKVQTWRKALE

ProfileScan: PS50104
IPR000157
20-157 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WDYDVFPSFHGEDVRKAFLSQILKKEFGRKAINFFVDHEMERGEFIGPVLKQAIKGSKIALVLLSKNYASSWCCLDELVEIMKKESGQTVITIFYEVDPNEVKKQTGDFGKAFKETCQGKTEEKVQTWRKALEGVGLA

HMMSmart: SM00255
IPR000157
21-157 TIR
Toll/interleukin-1 receptor homology (TIR) domain

DYDVFPSFHGEDVRKAFLSQILKKEFGRKAINFFVDHEMERGEFIGPVLKQAIKGSKIALVLLSKNYASSWCCLDELVEIMKKESGQTVITIFYEVDPNEVKKQTGDFGKAFKETCQGKTEEKVQTWRKALEGVGLA

HMMPfam: PF01582
IPR000157
24-151 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFHGEDVRKAFLSQILKKEFGRKAINFFVDHEMERGEFIGPVLKQAIKGSKIALVLLSKNYASSWCCLDELVEIMKKESGQTVITIFYEVDPNEVKKQTGDFGKAFKETCQGKTEEKVQTWRKAL

HMMPanther: PTHR23155
33-167 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VRKAFLSQILKKEFGRKAINFFVDHEMERGEFIGPVLKQAIKGSKIALVLLSKNYASSWCCLDELVEIMKKESGQTVITIFYEVDPNEVKKQTGDFGKAFKETCQGKTEEKVQTWRKALEGVGLATIAGFHSSNW

HMMPanther: PTHR23155:SF297
33-167 PTHR23155:SF297

VRKAFLSQILKKEFGRKAINFFVDHEMERGEFIGPVLKQAIKGSKIALVLLSKNYASSWCCLDELVEIMKKESGQTVITIFYEVDPNEVKKQTGDFGKAFKETCQGKTEEKVQTWRKALEGVGLATIAGFHSSNW






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox