PRGDB00047276 (disease resistance protein (TIR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18404238 (NM_104168)
Gene Class T
Domain Type TIR, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR class), putative (AT1G52900) mRNA, complete cds.

DNA Sequence

ATGATCTCTAGGGTTTTCAACTTCATGAAACAATCCGAAACAGTTCAGCTAAACAACAAACTATTTCTCGATCTCCTCTCTTCCTCGTCATCGGCCAAACCCAAAATTTTGCACGACGTGTTCATCAACCACAGAGGATCCGACACAAAGAGAAACATCGCAACATTGCTTTATGACAATCTCAAATCTCGTAACTTACGTCCATTCTTGGATTCCAAGAACATGAAGCCCGGAGATAAGCTTTTTGATCATATCAACAACGCGATTCTCACTTCTAAAGTCGCTGTAACGGTTTTTTCTCCTAACTACTGCGATTCATATTTCTGTCTGCACGAGCTTGCTCTTATAATGGAGTCCAGAAAAAGGGTCATACCGATATTCTGCGACATCAAACCTTCACAACTCGATGTTATGATCGAGAGGGTGACATGTTCTGATGATGAAATCCAAAGGTTTAGATGGGCCCTTCAAGAAGCTAAAGATATCGTTGGACTCACGTTTGATTCCTACAAAGGGAATTTATCGGAGGTTGTTACAGTTGCATCGGATGTTATCGTCGAGAGATTGGTCGAGTTAGAGGCTAAAGATGAAAATCTATAG


Protein sequences

Name Description Sequence
disease resistance protein (TIR class), putative disease resistance protein (TIR class), putative [Arabidopsis thaliana].

MISRVFNFMKQSETVQLNNKLFLDLLSSSSSAKPKILHDVFINHRGSDTKRNIATLLYDNLKSRNLRPFLDSKNMKPGDKLFDHINNAILTSKVAVTVFSPNYCDSYFCLHELALIMESRKRVIPIFCDIKPSQLDVMIERVTCSDDEIQRFRWALQEAKDIVGLTFDSYKGNLSEVVTVASDVIVERLVELEAKDENL

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
26-165 TIR
Toll/interleukin-1 receptor homology (TIR) domain

LSSSSSAKPKILHDVFINHRGSDTKRNIATLLYDNLKSRNLRPFLDSKNMKPGDKLFDHINNAILTSKVAVTVFSPNYCDSYFCLHELALIMESRKRVIPIFCDIKPSQLDVMIERVTCSDDEIQRFRWALQEAKDIVGL

Gene3D: G3DSA:3.40.50.10140
36-138 G3DSA:3.40.50.10140

ILHDVFINHRGSDTKRNIATLLYDNLKSRNLRPFLDSKNMKPGDKLFDHINNAILTSKVAVTVFSPNYCDSYFCLHELALIMESRKRVIPIFCDIKPSQLDVM

ProfileScan: PS50104
IPR000157
36-152 TIR
Toll/interleukin-1 receptor homology (TIR) domain

ILHDVFINHRGSDTKRNIATLLYDNLKSRNLRPFLDSKNMKPGDKLFDHINNAILTSKVAVTVFSPNYCDSYFCLHELALIMESRKRVIPIFCDIKPSQLDVMIERVTCSDDEIQRF

HMMSmart: SM00255
IPR000157
37-184 TIR
Toll/interleukin-1 receptor homology (TIR) domain

LHDVFINHRGSDTKRNIATLLYDNLKSRNLRPFLDSKNMKPGDKLFDHINNAILTSKVAVTVFSPNYCDSYFCLHELALIMESRKRVIPIFCDIKPSQLDVMIERVTCSDDEIQRFRWALQEAKDIVGLTFDSYKGNLSEVVTVASDV

HMMPfam: PF13676
40-140 TIR_2,TIR domain

VFINHRGSDTKRNIATLLYDNLKSRNLRPFLDSKNMKPGDKLFDHINNAILTSKVAVTVFSPNYCDSYFCLHELALIMESRKRVIPIFCDIKPSQLDVMIE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox