PRGDB00047277 (disease resistance protein (TIR-NBS class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 145337467 (NM_105950)
Gene Class T
Domain Type TIR, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS class), putative (AT1G72920) mRNA, complete cds.

DNA Sequence

ATGTCTTCTCCTACTGCGACTAAGTACGACGTCTTTCTGAGTTTCAGAGGACTCGACACTCGTCGCAACTTCATCAGTTTTCTCTACAAAGAACTCGTTCGAAGAAAAATTCGAACTTTCAAAGACGACAAGGAGCTCGAGAATGGCCGGAGGATTTCTCCGGAGCTCAAACGCGCCATCGAGGAGTCGAAATTCGCCGTCGTTGTGGTCTCTGTGAACTACGCTGCGTCTCCTTGGTGTCTCGATGAGCTTGTGAAGATTATGGATTTCGAAAACAAGGGTTCCATCACCGTGATGCCTATCTTCTACGGCGTGGATCCTTGTCATTTGAGGAGGCAGATCGGAGATGTCGCTGAACAGTTTAAGAAGCACGAGGCTAGAGAAGAAGATCATGAGAAAGTAGCTTCGTGGAGACGAGCATTGACCAGTTTAGCGAGTATCTCCGGCGAATGTTCATTGAAATGGGAAGATGAAGCGAATCTGGTGGACGAAATTGCTGACAAGATATCAAAAAATCTGATGACTGTTACAACAATAAGCAATGGGAGGGACCTAGTTGGGATTGATACACACATGAAGGCTCTTAACAAAAAATTGGATTTGAATTCCAACAAAAGTTTGAGAGTGGTTGGGATTTGGGCAAGAGGATACAATGGTAGATCAGCTTTAGCTAAATATGTTTATCAAGACATCTGTCATTGGTTGAAGGTTGGTTGGTTGAAGGTTTATCAAGATATCAAGACAGCTTCCAAACTTTATGTTTTAACTCGTTGGTTGAAGGTTGCACATTTGCTTCATAGATCACATCACTCTTTTAAAACTGAGTAG


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS class), putative disease resistance protein (TIR-NBS class), putative [Arabidopsis thaliana].

MSSPTATKYDVFLSFRGLDTRRNFISFLYKELVRRKIRTFKDDKELENGRRISPELKRAIEESKFAVVVVSVNYAASPWCLDELVKIMDFENKGSITVMPIFYGVDPCHLRRQIGDVAEQFKKHEAREEDHEKVASWRRALTSLASISGECSLKWEDEANLVDEIADKISKNLMTVTTISNGRDLVGIDTHMKALNKKLDLNSNKSLRVVGIWARGYNGRSALAKYVYQDICHWLKVGWLKVYQDIKTASKLYVLTRWLKVAHLLHRSHHSFKTE

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
2-150 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SSPTATKYDVFLSFRGLDTRRNFISFLYKELVRRKIRTFKDDKELENGRRISPELKRAIEESKFAVVVVSVNYAASPWCLDELVKIMDFENKGSITVMPIFYGVDPCHLRRQIGDVAEQFKKHEAREEDHEKVASWRRALTSLASISGE

ProfileScan: PS50104
IPR000157
7-147 TIR
Toll/interleukin-1 receptor homology (TIR) domain

TKYDVFLSFRGLDTRRNFISFLYKELVRRKIRTFKDDKELENGRRISPELKRAIEESKFAVVVVSVNYAASPWCLDELVKIMDFENKGSITVMPIFYGVDPCHLRRQIGDVAEQFKKHEAREEDHEKVASWRRALTSLASI

Gene3D: G3DSA:3.40.50.10140
7-145 G3DSA:3.40.50.10140

TKYDVFLSFRGLDTRRNFISFLYKELVRRKIRTFKDDKELENGRRISPELKRAIEESKFAVVVVSVNYAASPWCLDELVKIMDFENKGSITVMPIFYGVDPCHLRRQIGDVAEQFKKHEAREEDHEKVASWRRALTSLA

HMMSmart: SM00255
IPR000157
8-147 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KYDVFLSFRGLDTRRNFISFLYKELVRRKIRTFKDDKELENGRRISPELKRAIEESKFAVVVVSVNYAASPWCLDELVKIMDFENKGSITVMPIFYGVDPCHLRRQIGDVAEQFKKHEAREEDHEKVASWRRALTSLASI

HMMPfam: PF01582
IPR000157
11-142 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGLDTRRNFISFLYKELVRRKIRTFKDDKELENGRRISPELKRAIEESKFAVVVVSVNYAASPWCLDELVKIMDFENKGSITVMPIFYGVDPCHLRRQIGDVAEQFKKHEAREEDHEKVASWRRALT

HMMPanther: PTHR23155
20-228 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TRRNFISFLYKELVRRKIRTFKDDKELENGRRISPELKRAIEESKFAVVVVSVNYAASPWCLDELVKIMDFENKGSITVMPIFYGVDPCHLRRQIGDVAEQFKKHEAREEDHEKVASWRRALTSLASISGECSLKWEDEANLVDEIADKISKNLMTVTTISNGRDLVGIDTHMKALNKKLDLNSNKSLRVVGIWARGYNGRSALAKYVY

HMMPanther: PTHR23155:SF344
20-228 PTHR23155:SF344

TRRNFISFLYKELVRRKIRTFKDDKELENGRRISPELKRAIEESKFAVVVVSVNYAASPWCLDELVKIMDFENKGSITVMPIFYGVDPCHLRRQIGDVAEQFKKHEAREEDHEKVASWRRALTSLASISGECSLKWEDEANLVDEIADKISKNLMTVTTISNGRDLVGIDTHMKALNKKLDLNSNKSLRVVGIWARGYNGRSALAKYVY






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox