PRGDB00047297 (LRR)

From PRG Wiki
Jump to: navigation, search
LRR
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 167594026 (EU424347)
Gene Class RLP
Domain Type LRR, LRR, Ser-Thr Kinase
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis LRR-like disease resistance protein (LRR) mRNA, complete cds.

DNA Sequence

ATGGCTTCTCGGTGTGAGCTACTCCTGATCTGCGTCTTGTCTCTCCTCTTCGCTGTCTCTTACTCCAAGACGTTGAAGCGAGACGTGAAGGCTTTGAATGAAATCAAAGCATCTTTGGGATGGAGAGTGGTGTATTCATGGGTTGGTGATGATCCTTGTGGAGATGGAGACCTTCCTCCTTGGTCTGGTGTCACCTGCTCTACACAAGGTGACTATAGGGTCGTCACTGAGTTAGAGGTTTATGCGGTTTCGATTGTTGGACCCTTCCCCATTGCAGTTACGAACCTTCTGGATCTCACTAGACTGGATCTACATAACAACAAGCTCACTGGTCCAATCCCTCCCCAGATTGGACGCCTGAAACGGCTTAAAGTACTATACCTGAGGTGGAATAAACTGCAAGATGTGATTCCCCCTGAGATTGGGGAGCTCAAGAGACTAACGCATTTGTACTTGAGCTTCAATAGCTTTAAGGGAGAAATTCCAAAGGAATTGGCTGCTCTTCCGGAGCTTCGGTATCTATACCTTCAAGAAAACCGTCTCATTGGTAGAATTCCTGCTGAACTGGGGACGCTTCAAAACCTCCGCCATCTAGATGCTGGTAATAATCATTTGGTGGGAACTATAAGAGAGCTCATCCGTTTTGATGGTAGTTTCCCATCTCTTCGCAACCTGTACTTGAATAATAACTATTTGAGTGGAGGAATCCCTGCGCAGCTATCAAATCTTACAAGCTTAGAGATTGTGTACCTGTCTTACAACAAATTTATTGGAAACATTCCTTTTGCCATTGCTCATATTCCTAAGCTGACATTCCTGTATCTTGATCACAACCAATTCACTGGGAGAATCCCAGACGCATTCTACAAGCATCCATTCCTCAAAGAAATGTACATTGAAGGCAACATGTTCAAATCAGGCGTGAACCCAATTGGTACCCACAAAGTTCTAGAAGTTTCTGATGCTGATTTTGCTGTGTGGTGA


Protein sequences

Name Description Sequence
LRR-like disease resistance protein LRR-like disease resistance protein [Brassica rapa subsp. pekinensis].

MASRCELLLICVLSLLFAVSYSKTLKRDVKALNEIKASLGWRVVYSWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNLLDLTRLDLHNNKLTGPIPPQIGRLKRLKVLYLRWNKLQDVIPPEIGELKRLTHLYLSFNSFKGEIPKELAALPELRYLYLQENRLIGRIPAELGTLQNLRHLDAGNNHLVGTIRELIRFDGSFPSLRNLYLNNNYLSGGIPAQLSNLTSLEIVYLSYNKFIGNIPFAIAHIPKLTFLYLDHNQFTGRIPDAFYKHPFLKEMYIEGNMFKSGVNPIGTHKVLEVSDADFAVW


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-304 PTHR24420,FAMILY NOT NAMED

MASRCELLLICVLSLLFAVSYSKTLKRDVKALNEIKASLGWRVVYSWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNLLDLTRLDLHNNKLTGPIPPQIGRLKRLKVLYLRWNKLQDVIPPEIGELKRLTHLYLSFNSFKGEIPKELAALPELRYLYLQENRLIGRIPAELGTLQNLRHLDAGNNHLVGTIRELIRFDGSFPSLRNLYLNNNYLSGGIPAQLSNLTSLEIVYLSYNKFIGNIPFAIAHIPKLTFLYLDHNQFTGRIPDAFYKHPFLKEMYIEGNMF

HMMPanther: PTHR24420:SF518
1-304 PTHR24420:SF518

MASRCELLLICVLSLLFAVSYSKTLKRDVKALNEIKASLGWRVVYSWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNLLDLTRLDLHNNKLTGPIPPQIGRLKRLKVLYLRWNKLQDVIPPEIGELKRLTHLYLSFNSFKGEIPKELAALPELRYLYLQENRLIGRIPAELGTLQNLRHLDAGNNHLVGTIRELIRFDGSFPSLRNLYLNNNYLSGGIPAQLSNLTSLEIVYLSYNKFIGNIPFAIAHIPKLTFLYLDHNQFTGRIPDAFYKHPFLKEMYIEGNMF

superfamily: SSF52058
22-314 SSF52058,LRR

SKTLKRDVKALNEIKASLGWRVVYSWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNLLDLTRLDLHNNKLTGPIPPQIGRLKRLKVLYLRWNKLQDVIPPEIGELKRLTHLYLSFNSFKGEIPKELAALPELRYLYLQENRLIGRIPAELGTLQNLRHLDAGNNHLVGTIRELIRFDGSFPSLRNLYLNNNYLSGGIPAQLSNLTSLEIVYLSYNKFIGNIPFAIAHIPKLTFLYLDHNQFTGRIPDAFYKHPFLKEMYIEGNMFKSGVNPIGTH

HMMPfam: PF08263
IPR013210
26-67 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

KRDVKALNEIKASLGWRVVYSWVGDDPCGDGDLPPWSGVTCS

Gene3D: G3DSA:3.80.10.10
60-309 G3DSA:3.80.10.10

PWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNLLDLTRLDLHNNKLTGPIPPQIGRLKRLKVLYLRWNKLQDVIPPEIGELKRLTHLYLSFNSFKGEIPKELAALPELRYLYLQENRLIGRIPAELGTLQNLRHLDAGNNHLVGTIRELIRFDGSFPSLRNLYLNNNYLSGGIPAQLSNLTSLEIVYLSYNKFIGNIPFAIAHIPKLTFLYLDHNQFTGRIPDAFYKHPFLKEMYIEGNMFKSGVN

HMMPfam: PF00560
IPR001611
99-119 LRR_1
Leucine-rich repeat

LTRLDLHNNKLTGPIPPQIGR

HMMPfam: PF12799
121-158 LRR_4,Leucine Rich repeats (2 copies)

KRLKVLYLRWNKLQDVIPPEIGELKRLTHLYLSFNSFK

HMMPfam: PF12799
169-205 LRR_4,Leucine Rich repeats (2 copies)

PELRYLYLQENRLIGRIPAELGTLQNLRHLDAGNNHL

HMMPfam: PF13855
220-279 LRR_8,Leucine rich repeat

PSLRNLYLNNNYLSGGIPAQLSNLTSLEIVYLSYNKFIGNIPFAIAHIPKLTFLYLDHNQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox