PRGDB00047299 (rga S-120)

From PRG Wiki
Jump to: navigation, search
rga S-120
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 28555913 (AJ507100)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Hordeum vulgare

Comment?

Hordeum vulgare partial mRNA for NBS-LRR disease resistance protein homologue (rga S-120 gene).

DNA Sequence

CTGGACCATACCACACCACGCAGCTCGCCTACGCCTCTACGGTGAGGTCATGGCGGAGATGATCGCGATATCGCTCTCGGCGAAGGTCGCCGCAACACTGTCAGGCAGTGCGGCCGCCGACTTCTCCTCTCTCGTGGCCGTCCGCTCGGGCATCGCCGCCGCGGCGCGGGACCTGGAGCTCCTCCGCGCGTTCCTCCGGTTCGCCGACTCCCGCCGCGGCGAGGACGCGCTCGCCTCCGCCTGGGTGGACCAGATCCGGGACGTCGGATTCGAGCTGGAGGACGTCGCGGACGAGTACGCCTTCCTCTCCGGCGGCGGCTTCGTCCGCGCCTGCGCTAACTTCGGCGCGTGGCTCGCTCTGGCCAGACGGCTAGGCAAGGCGCGGGTGAGGCTCCGCGACCTGTCGGATGCCAAGGAGCGGTACGGCATCCGGCCGGCCGAGGCCTCGGCTTCAAGCCCCGCCCCTGACAGCGGCACCGGAGCCGTCGTAGGCCGGAAGCTAGCCGAAGCAGCGCATTTCTTGGAGGATGGGGAGATCGTCGGCTTCGCGGCGCACAGAAGGTCACTGATGAAATGGCTCACGGAGGACCTCGACTCCCGGCGGTCTTTGGTTGCTGTGTGCGGGATGGGCGGCGTTGGCAAGACCACCCTGGTCACCAGCGTGTACAAGGAAGTCGCCGCAAGCCGCCACTTCGACTGCGCTGCGTGGGTGTCCGTCTCCAAGAACTTCACGACGGATGACCTCCTAAGGAAAATTGCCAAAGAACTGCACAGGGACGTCCGTGCCGGCATGCCGGACATTGATGAGATGGACTACCGGTCGCTGGTGGAAGCTTTGCGTGGGCATCTCGCCCAGAAGAGGTACTTATTATTGCTGGACGATGTCTGGGATGCCCATGCATGGTATGAAATCCGCAATGCGTTGGTTGATGATGGACAAGGGAGCAAGATAATCATCACAACACGCAGTCAAGATGTTGCCTCTCTGGCAGCATCCACCAGGATCATCATGTTGGAACCGCTCCCCAAGCAAGAAGCATGGTCCTTGTTTTGTAACACCACATTCAGGGAAGATGCCAATCAGGAGTGCCCACATCATCTGGAGCAGTGGGCTTTCAAGATATTGGACAGATGTTGTGGTCTACCATTAGCAATTGTATCAGTTGGCAACCTCCTTGCATTGAAGAGTAGAACGGAATTTGCTTGGAAGAATGTCCATGACAGCCTTGACTGGGATGGAAGCAGTGTTCGTGGAATTGGGGAAGTGTCAAGCATACTCAATCTGAGCATTGATGATCTGCCTTATCACCTGAAGAGATGTTTACTGTATTGCAGTATATACCCTGAAGATTTCTTGATCAAAAGGAAAATTCTGATCAGGTTGTGGATTGCACAAGGCTATATTGAGGAAAAGGGCCAGGGCACAATGGAGGAGATTGCGGATGATTACCTGCACCAGCTAGTGCAACGTAGCCTGTTGCAGGTCACGTTAAAGAATGAGTTTGGACGAGCAAAACGGCTCTGCATTCATGACCTGATCAGGGATTTGATTCTGCAAAGGTCAATAAAGGAAGGGTTTACCGTATTCTCGAAATGTCAGCCAACATTGGGGCCAAGCAAAAAAATCCGTCATCTTATACTTGACCGATGGGTAAGTGATCATCGACCAGTTCTAAAGATGACATTGCTTCGCTCCTTCAACTCATTTAAGTCAGATATAGATTCTTCAGTCTTGTCTGGCTTTAGGTTATTGACCGTATTAAACTTATGGTTTGTCCAGATAGATAAACTGCCTAGCTCACTGAGCAATCTTCTTAATCTGCGGTATCTTGGGATCCGTTCCACTCTCATTGAAGAGCTTCCACAGGATTTGGGACAGTTACATAAGTTGCAAACTTTAGATACAAAGTGGTCCAGGGTCCAGAGACTACCACCTAGTATAAGAAAGCTCAATAACCTGCGCCACCTGATAGTGTTTAGGCGCCGATCTGCAGACTTCAGGTTTGCGTTCCCTGGTACAGCAATTGAATTTCCAGACGGGCTACAAAATCTTACCTGCCTGCAGACTCTAAAGTACATCGAGGCTGATGAGAAGATGGTCAAATCCTTAAAAAGCTTAAAGCATATGAAGAGCTTAGAGCTATCCGGTGTGCATGAGAGTAATCTTATTCATTTGCCCTCATCCATCTCCACAATGAGCGGCCTTCTGTGCTTGGGGATTGTCAGTCGGGATGCTAATGTCATATTGGACCTGGAGCCATTTTATCCACCCCCACTAAAGCTTCAGAGACTTTCATTGACAGGGATGTTAGCCAGAGGTAAGTTGCCTTCATGGTTTGGGCACCTTGATAACCTCATGCAGTTGCGTTTGTGTTCATCTGAGCTCAGAGGAGATTCAATTGGATTGCTCTCATCACTTCCCAGGCTGTTACATCTTACCCTAAAGAATGCATACACCGACAAGAGTTTATCCTTTCCAGAAGGCAGTTTTCCAGTTCTTAAGAAGCTGAGCTTACATGAGTTGCCTAACCTTTCTCACATTGAGTTTCAAAAAGGGAGTCTTCTACATCTAAATGTATTAATCCTAGGCCGTTGTGATGAGCTAACTGAAATACCCCAAGGCATCGAGAATCTTATAGAGCTCGACAACCTGGAGCTTTATGAAATGCCAAGTGAGATAATAGAAAAGATTCAAGACAGGGAAACATTAGTTGGGGATTATAAAGATTCTCGACGTACTACAACTGTTAAGAACACCGTCTGGTATAATGGACAATTGTTGCAGAAAACAATTTACACCAACCTATTCACTATTCAAATTTAG


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein homologue NBS-LRR disease resistance protein homologue [Hordeum vulgare].

WTIPHHAARLRLYGEVMAEMIAISLSAKVAATLSGSAAADFSSLVAVRSGIAAAARDLELLRAFLRFADSRRGEDALASAWVDQIRDVGFELEDVADEYAFLSGGGFVRACANFGAWLALARRLGKARVRLRDLSDAKERYGIRPAEASASSPAPDSGTGAVVGRKLAEAAHFLEDGEIVGFAAHRRSLMKWLTEDLDSRRSLVAVCGMGGVGKTTLVTSVYKEVAASRHFDCAAWVSVSKNFTTDDLLRKIAKELHRDVRAGMPDIDEMDYRSLVEALRGHLAQKRYLLLLDDVWDAHAWYEIRNALVDDGQGSKIIITTRSQDVASLAASTRIIMLEPLPKQEAWSLFCNTTFREDANQECPHHLEQWAFKILDRCCGLPLAIVSVGNLLALKSRTEFAWKNVHDSLDWDGSSVRGIGEVSSILNLSIDDLPYHLKRCLLYCSIYPEDFLIKRKILIRLWIAQGYIEEKGQGTMEEIADDYLHQLVQRSLLQVTLKNEFGRAKRLCIHDLIRDLILQRSIKEGFTVFSKCQPTLGPSKKIRHLILDRWVSDHRPVLKMTLLRSFNSFKSDIDSSVLSGFRLLTVLNLWFVQIDKLPSSLSNLLNLRYLGIRSTLIEELPQDLGQLHKLQTLDTKWSRVQRLPPSIRKLNNLRHLIVFRRRSADFRFAFPGTAIEFPDGLQNLTCLQTLKYIEADEKMVKSLKSLKHMKSLELSGVHESNLIHLPSSISTMSGLLCLGIVSRDANVILDLEPFYPPPLKLQRLSLTGMLARGKLPSWFGHLDNLMQLRLCSSELRGDSIGLLSSLPRLLHLTLKNAYTDKSLSFPEGSFPVLKKLSLHELPNLSHIEFQKGSLLHLNVLILGRCDELTEIPQGIENLIELDNLELYEMPSEIIEKIQDRETLVGDYKDSRRTTTVKNTVWYNGQLLQKTIYTNLFTIQI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
19-933 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

EMIAISLSAKVAATLSGSAAADFSSLVAVRSGIAAAARDLELLRAFLRFADSRRGEDALASAWVDQIRDVGFELEDVADEYAFLSGGGFVRACANFGAWLALARRLGKARVRLRDLSDAKERYGIRPAEASASSPAPDSGTGAVVGRKLAEAAHFLEDGEIVGFAAHRRSLMKWLTEDLDSRRSLVAVCGMGGVGKTTLVTSVYKEVAASRHFDCAAWVSVSKNFTTDDLLRKIAKELHRDVRAGMPDIDEMDYRSLVEALRGHLAQKRYLLLLDDVWDAHAWYEIRNALVDDGQGSKIIITTRSQDVASLAASTRIIMLEPLPKQEAWSLFCNTTFREDANQECPHHLEQWAFKILDRCCGLPLAIVSVGNLLALKSRTEFAWKNVHDSLDWDGSSVRGIGEVSSILNLSIDDLPYHLKRCLLYCSIYPEDFLIKRKILIRLWIAQGYIEEKGQGTMEEIADDYLHQLVQRSLLQVTLKNEFGRAKRLCIHDLIRDLILQRSIKEGFTVFSKCQPTLGPSKKIRHLILDRWVSDHRPVLKMTLLRSFNSFKSDIDSSVLSGFRLLTVLNLWFVQIDKLPSSLSNLLNLRYLGIRSTLIEELPQDLGQLHKLQTLDTKWSRVQRLPPSIRKLNNLRHLIVFRRRSADFRFAFPGTAIEFPDGLQNLTCLQTLKYIEADEKMVKSLKSLKHMKSLELSGVHESNLIHLPSSISTMSGLLCLGIVSRDANVILDLEPFYPPPLKLQRLSLTGMLARGKLPSWFGHLDNLMQLRLCSSELRGDSIGLLSSLPRLLHLTLKNAYTDKSLSFPEGSFPVLKKLSLHELPNLSHIEFQKGSLLHLNVLILGRCDELTEIPQGIENLIELDNLELYEMPSEIIEKIQDRETLVGDYKDSRRTTTVKNTVWYNGQLLQKTIYT

HMMPanther: PTHR23155:SF145
19-933 PTHR23155:SF145,OS04G0548100 PROTEIN (FRAGMENT)

EMIAISLSAKVAATLSGSAAADFSSLVAVRSGIAAAARDLELLRAFLRFADSRRGEDALASAWVDQIRDVGFELEDVADEYAFLSGGGFVRACANFGAWLALARRLGKARVRLRDLSDAKERYGIRPAEASASSPAPDSGTGAVVGRKLAEAAHFLEDGEIVGFAAHRRSLMKWLTEDLDSRRSLVAVCGMGGVGKTTLVTSVYKEVAASRHFDCAAWVSVSKNFTTDDLLRKIAKELHRDVRAGMPDIDEMDYRSLVEALRGHLAQKRYLLLLDDVWDAHAWYEIRNALVDDGQGSKIIITTRSQDVASLAASTRIIMLEPLPKQEAWSLFCNTTFREDANQECPHHLEQWAFKILDRCCGLPLAIVSVGNLLALKSRTEFAWKNVHDSLDWDGSSVRGIGEVSSILNLSIDDLPYHLKRCLLYCSIYPEDFLIKRKILIRLWIAQGYIEEKGQGTMEEIADDYLHQLVQRSLLQVTLKNEFGRAKRLCIHDLIRDLILQRSIKEGFTVFSKCQPTLGPSKKIRHLILDRWVSDHRPVLKMTLLRSFNSFKSDIDSSVLSGFRLLTVLNLWFVQIDKLPSSLSNLLNLRYLGIRSTLIEELPQDLGQLHKLQTLDTKWSRVQRLPPSIRKLNNLRHLIVFRRRSADFRFAFPGTAIEFPDGLQNLTCLQTLKYIEADEKMVKSLKSLKHMKSLELSGVHESNLIHLPSSISTMSGLLCLGIVSRDANVILDLEPFYPPPLKLQRLSLTGMLARGKLPSWFGHLDNLMQLRLCSSELRGDSIGLLSSLPRLLHLTLKNAYTDKSLSFPEGSFPVLKKLSLHELPNLSHIEFQKGSLLHLNVLILGRCDELTEIPQGIENLIELDNLELYEMPSEIIEKIQDRETLVGDYKDSRRTTTVKNTVWYNGQLLQKTIYT

superfamily: SSF52540
162-415 SSF52540

VVGRKLAEAAHFLEDGEIVGFAAHRRSLMKWLTEDLDSRRSLVAVCGMGGVGKTTLVTSVYKEVAASRHFDCAAWVSVSKNFTTDDLLRKIAKELHRDVRAGMPDIDEMDYRSLVEALRGHLAQKRYLLLLDDVWDAHAWYEIRNALVDDGQGSKIIITTRSQDVASLAASTRIIMLEPLPKQEAWSLFCNTTFREDANQECPHHLEQWAFKILDRCCGLPLAIVSVGNLLALKSRTEFAWKNVHDSLDWDGSS

HMMPfam: PF00931
IPR002182
186-470 NB-ARC,NBS
NB-ARC

RRSLMKWLTEDLDSRRSLVAVCGMGGVGKTTLVTSVYKEVAASRHFDCAAWVSVSKNFTTDDLLRKIAKELHRDVRAGMPDIDEMDYRSLVEALRGHLAQKRYLLLLDDVWDAHAWYEIRNALVDDGQGSKIIITTRSQDVASLAASTRIIMLEPLPKQEAWSLFCNTTFREDANQECPHHLEQWAFKILDRCCGLPLAIVSVGNLLALKSRTEFAWKNVHDSLDWDGSSVRGIGEVSSILNLSIDDLPYHLKRCLLYCSIYPEDFLIKRKILIRLWIAQGYIEE

Gene3D: G3DSA:3.40.50.300
188-328 G3DSA:3.40.50.300

SLMKWLTEDLDSRRSLVAVCGMGGVGKTTLVTSVYKEVAASRHFDCAAWVSVSKNFTTDDLLRKIAKELHRDVRAGMPDIDEMDYRSLVEALRGHLAQKRYLLLLDDVWDAHAWYEIRNALVDDGQGSKIIITTRSQDVAS

HMMSmart: SM00382
IPR003593
200-342 AAA,NBS
AAA+ ATPase domain

RRSLVAVCGMGGVGKTTLVTSVYKEVAASRHFDCAAWVSVSKNFTTDDLLRKIAKELHRDVRAGMPDIDEMDYRSLVEALRGHLAQKRYLLLLDDVWDAHAWYEIRNALVDDGQGSKIIITTRSQDVASLAASTRIIMLEPLP

FPrintScan: PR00364
IPR000767
203-218 DISEASERSIST
Disease resistance protein

LVAVCGMGGVGKTTLV

FPrintScan: PR00364
IPR000767
282-296 DISEASERSIST
Disease resistance protein

HLAQKRYLLLLDDVW

FPrintScan: PR00364
IPR000767
378-392 DISEASERSIST
Disease resistance protein

CCGLPLAIVSVGNLL

superfamily: SSF52058
508-890 SSF52058,LRR

CIHDLIRDLILQRSIKEGFTVFSKCQPTLGPSKKIRHLILDRWVSDHRPVLKMTLLRSFNSFKSDIDSSVLSGFRLLTVLNLWFVQIDKLPSSLSNLLNLRYLGIRSTLIEELPQDLGQLHKLQTLDTKWSRVQRLPPSIRKLNNLRHLIVFRRRSADFRFAFPGTAIEFPDGLQNLTCLQTLKYIEADEKMVKSLKSLKHMKSLELSGVHESNLIHLPSSISTMSGLLCLGIVSRDANVILDLEPFYPPPLKLQRLSLTGMLARGKLPSWFGHLDNLMQLRLCSSELRGDSIGLLSSLPRLLHLTLKNAYTDKSLSFPEGSFPVLKKLSLHELPNLSHIEFQKGSLLHLNVLILGRCDELTEIPQGIENLIELDNLELYEMP

Gene3D: G3DSA:3.80.10.10
564-724 G3DSA:3.80.10.10

RSFNSFKSDIDSSVLSGFRLLTVLNLWFVQIDKLPSSLSNLLNLRYLGIRSTLIEELPQDLGQLHKLQTLDTKWSRVQRLPPSIRKLNNLRHLIVFRRRSADFRFAFPGTAIEFPDGLQNLTCLQTLKYIEADEKMVKSLKSLKHMKSLELSGVHESNLIH

FPrintScan: PR00364
IPR000767
704-720 DISEASERSIST
Disease resistance protein

KSLKHMKSLELSGVHES

Gene3D: G3DSA:3.80.10.10
754-887 G3DSA:3.80.10.10

FYPPPLKLQRLSLTGMLARGKLPSWFGHLDNLMQLRLCSSELRGDSIGLLSSLPRLLHLTLKNAYTDKSLSFPEGSFPVLKKLSLHELPNLSHIEFQKGSLLHLNVLILGRCDELTEIPQGIENLIELDNLELY


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox