PRGDB00047300 (rga s-reg19)

From PRG Wiki
Jump to: navigation, search
rga s-reg19
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 28555911 (AJ507099)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Hordeum vulgare

Comment?

Hordeum vulgare partial mRNA for NBS-LRR disease resistance protein homologue (rga s-reg19 gene).

DNA Sequence

TGGAAGATAAGCGGATAGAGGCATGGTGGAAGAACATGAGCAATGTAATGTTTGATATTGATGTCATCATAGATCTTGTTATGGTTCATTCGCAAAAGCTTTTGCTGCCACCTAGATCAGTATGTTGCAATCAGTCCATGATCTCTTGTTTTGGAAAGCTTTCATTTGATCACAGAGTGGCTAGAAGAATCAAGGACATAAATGAAAAGCTTGATGAGATCAAAATGAACACAGAGATGTTCACCTTGGATAGAACCACACGCCAACAATTCCAAGTAACAATTGTGGATAGAAGGCAGACATCTCCTGTAGATGAACTAGAGGTTGTTGGAACAGAAATCAAACAGGCAGGTGAGGACATGGTACAAATGATTGTTAGTAGCTGTCGTGAGAATCGGTCAAGTGTTTTTGGGATTCAAGGGATGGGAGGCATCGGTAAGACAACATTAGCTCAGAAGATATATAATGAGCCGTTGGTAAGAGAGAAATTCCAAGTTCGTATATGGTTGTGCATTTCACAGAGCTACACAGAAACCGGGTTGATAAAGCAGGCAATACGAATGGCAGGAGAAAAGTGTGACCAATTAGAGACCAAGACCGAGCTTCTTCCACTTCTGGTGGACTCTATCAAAGGAAAGAGTGTTCTTCTTGTGCTCGATGATGTGTGGAAATCTGATGTCTGGATTGATCTTTTTCTATCGCCTTTCAAGCGAGCCTTGAATTTCCATGTCCTTGTCACCACAAGAGACCTGGATGTATTGGCAGAAATGCATGCAACATATACTCACCAAGTAAACACAATGAATTATCATGATGGTTTGGAGTTGCTTATGAAGAAGTCCTTCCAGCCGTATGAGCAAATAAGTGAATTCAAGAATGTTGGGTATGAAATTGTAAAGAAATGCGACGGTCTTCCTCTTGCCATCAAGGTTGTTGCAGGTGTCCTATCTACCAAAAGAACAACTGCGGAATGGAAGAGTATCCGAGATAGCAAATGGTCCATTCATGGACTCCCCAAAGAACTTGGAGGCCCCCTGTATTTAAGTTACAGCAGCTTACCCCCTCAACTTAAGGAGTGCTTTCTCTGGTGTGCTTTGCTGCCTCCTAATTTTGAAATCCATCGTGATTCTGTAGCTTACTGGTGGGTTGCTGAAGGTTTAGTGAGGAAAGAGCATGGATTCTCAATACATGAAATTGCTGAAGAGTATTACCTTGAGCTAGTCCGGAGGAATCTTCTTCAACCTGTACCAGAGTATGTAGACAAGGCTGTGTCAACAATGCATGATCTATTAAGGTCACTCGGACAATATTTGACAAAGGATCACTCCCTGTGCATGAATGTGGAAAGAATCGATGCTATGTCGAATCTCCGCCGCTTAGGTATCAGTCATGCTGTAGAAGAAATACCCACTCTAGAAGAGCACAAGTGCTTGAGGAGCCTCCTACTTTTTAATAACAAGAATTTCAAATCAATGCACAAGGATATTTTCAGAAAGCTTGAGCATATCCGTGTCTTGGTTCTCAGTGGAACAAGCATCAAGGACATACCAGACTCAGTGGGAAACTTGGTGCTATTGAGGTTGCTAGATCTGAGCTATACAGAGATTAACAAACTTCCAGAGTCCATAGGAAGTCTCATCAGCCTTGAATACCTCTCTTTGCTTGGTTGCCGTCAATTGGATAGCCTGCCAGCTGGTCTCATGAGACTGTCCAACATAAGTTTTTTGCACCTAGAGCAGACTTCAATTGATCATGTTCCTAAAGGGATCGCAAAGTTTCAGCAGCTCTACAACCTAAGAGGAGTTTTTGAGAGCGGGACTGGATTCAGATTGGATGAATTGCGATGCCTCCCCAATATCCAACGTCTCTGGGTTAGTAAGCTAGAGGAAGCGATGCCAGGGAGCGAACTTGTACTGAAGAACAGTCGTAATCTTAAAGAACTGGGATTACGCTGCACAATGAAGATGGGTACTCATGATAGAACACGCTATGAGCACGACAAGGTTTGGAAAATTCAGCAAGTCTACGATATGCTCGTCCCGTCCCCAAGCCTAGAATACATTTTTCTTGTTGGGTTCCCTGGTACTATGTTCCCAGAATGGCTACGATCGAAACCGGAGCTTAACATGCCAAGTTTGCGTCAGATGCACCTTGACGAGTGCATATCATGTTCAGAGCTTCCACCAGCAGGTCAGATGCCACAACTGCAATTTCTTAAGATTAAAGGTGCAGATGCCATTGAGTCCATTGGCGAAGAACTCCTGGGAAAAGAAGCCGGCAGTCCAGCAGCCATTTTCCCAAAGCTTGAAGTGCTTCAGGTCATTCGCATGTTCAGTTTGAGAAGTTGGTCCCTCAACACTGGGAATCCCAGCGATAGCTCTCAACATATCTCGCTGATGCCTTGCCTTAAGCGTCTGTTGCTTCTTGATTGCCCAAAACTGAGAGCTCTCCCTCGAGACATGTCCAACATTGTTAACTTGAAGAGAATCCACATTGAAGGTGCTCACAAGCTGCAAGAAGTCGTTGACCTTCCCGCAGTCACGTGGCTCAAAGTGAAGAACAACACACGTTTGAGGACAATCTCCAATCTCTGTAAGCTTCAGGACTTGCTTGCGCAGGACTGCCCAGCACTGGACCAGGCAAAGAACCTATGCTCATTGAGGCGCTTGTACATGGTCGACTGCCCGCATGAGCAAGAGTTCAGGAAGTGCCTCTCAGAAGAACAAGGTGTTCTAGTCCACGTTGCAACGGTTGGTGCAGATGGCCGGAATATCTTCCCGGACGAATCTCTCTACAATTAG


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein homologue NBS-LRR disease resistance protein homologue [Hordeum vulgare].

EDKRIEAWWKNMSNVMFDIDVIIDLVMVHSQKLLLPPRSVCCNQSMISCFGKLSFDHRVARRIKDINEKLDEIKMNTEMFTLDRTTRQQFQVTIVDRRQTSPVDELEVVGTEIKQAGEDMVQMIVSSCRENRSSVFGIQGMGGIGKTTLAQKIYNEPLVREKFQVRIWLCISQSYTETGLIKQAIRMAGEKCDQLETKTELLPLLVDSIKGKSVLLVLDDVWKSDVWIDLFLSPFKRALNFHVLVTTRDLDVLAEMHATYTHQVNTMNYHDGLELLMKKSFQPYEQISEFKNVGYEIVKKCDGLPLAIKVVAGVLSTKRTTAEWKSIRDSKWSIHGLPKELGGPLYLSYSSLPPQLKECFLWCALLPPNFEIHRDSVAYWWVAEGLVRKEHGFSIHEIAEEYYLELVRRNLLQPVPEYVDKAVSTMHDLLRSLGQYLTKDHSLCMNVERIDAMSNLRRLGISHAVEEIPTLEEHKCLRSLLLFNNKNFKSMHKDIFRKLEHIRVLVLSGTSIKDIPDSVGNLVLLRLLDLSYTEINKLPESIGSLISLEYLSLLGCRQLDSLPAGLMRLSNISFLHLEQTSIDHVPKGIAKFQQLYNLRGVFESGTGFRLDELRCLPNIQRLWVSKLEEAMPGSELVLKNSRNLKELGLRCTMKMGTHDRTRYEHDKVWKIQQVYDMLVPSPSLEYIFLVGFPGTMFPEWLRSKPELNMPSLRQMHLDECISCSELPPAGQMPQLQFLKIKGADAIESIGEELLGKEAGSPAAIFPKLEVLQVIRMFSLRSWSLNTGNPSDSSQHISLMPCLKRLLLLDCPKLRALPRDMSNIVNLKRIHIEGAHKLQEVVDLPAVTWLKVKNNTRLRTISNLCKLQDLLAQDCPALDQAKNLCSLRRLYMVDCPHEQEFRKCLSEEQGVLVHVATVGADGRNIFPDESLYN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-889 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

EDKRIEAWWKNMSNVMFDIDVIIDLVMVHSQKLLLPPRSVCCNQSMISCFGKLSFDHRVARRIKDINEKLDEIKMNTEMFTLDRTTRQQFQVTIVDRRQTSPVDELEVVGTEIKQAGEDMVQMIVSSCRENRSSVFGIQGMGGIGKTTLAQKIYNEPLVREKFQVRIWLCISQSYTETGLIKQAIRMAGEKCDQLETKTELLPLLVDSIKGKSVLLVLDDVWKSDVWIDLFLSPFKRALNFHVLVTTRDLDVLAEMHATYTHQVNTMNYHDGLELLMKKSFQPYEQISEFKNVGYEIVKKCDGLPLAIKVVAGVLSTKRTTAEWKSIRDSKWSIHGLPKELGGPLYLSYSSLPPQLKECFLWCALLPPNFEIHRDSVAYWWVAEGLVRKEHGFSIHEIAEEYYLELVRRNLLQPVPEYVDKAVSTMHDLLRSLGQYLTKDHSLCMNVERIDAMSNLRRLGISHAVEEIPTLEEHKCLRSLLLFNNKNFKSMHKDIFRKLEHIRVLVLSGTSIKDIPDSVGNLVLLRLLDLSYTEINKLPESIGSLISLEYLSLLGCRQLDSLPAGLMRLSNISFLHLEQTSIDHVPKGIAKFQQLYNLRGVFESGTGFRLDELRCLPNIQRLWVSKLEEAMPGSELVLKNSRNLKELGLRCTMKMGTHDRTRYEHDKVWKIQQVYDMLVPSPSLEYIFLVGFPGTMFPEWLRSKPELNMPSLRQMHLDECISCSELPPAGQMPQLQFLKIKGADAIESIGEELLGKEAGSPAAIFPKLEVLQVIRMFSLRSWSLNTGNPSDSSQHISLMPCLKRLLLLDCPKLRALPRDMSNIVNLKRIHIEGAHKLQEVVDLPAVTWLKVKNNTRLRTISNLCKLQDLLAQDCPALDQAKNLCSLRRL

HMMPanther: PTHR23155:SF173
1-889 PTHR23155:SF173,OS08G0332600 PROTEIN

EDKRIEAWWKNMSNVMFDIDVIIDLVMVHSQKLLLPPRSVCCNQSMISCFGKLSFDHRVARRIKDINEKLDEIKMNTEMFTLDRTTRQQFQVTIVDRRQTSPVDELEVVGTEIKQAGEDMVQMIVSSCRENRSSVFGIQGMGGIGKTTLAQKIYNEPLVREKFQVRIWLCISQSYTETGLIKQAIRMAGEKCDQLETKTELLPLLVDSIKGKSVLLVLDDVWKSDVWIDLFLSPFKRALNFHVLVTTRDLDVLAEMHATYTHQVNTMNYHDGLELLMKKSFQPYEQISEFKNVGYEIVKKCDGLPLAIKVVAGVLSTKRTTAEWKSIRDSKWSIHGLPKELGGPLYLSYSSLPPQLKECFLWCALLPPNFEIHRDSVAYWWVAEGLVRKEHGFSIHEIAEEYYLELVRRNLLQPVPEYVDKAVSTMHDLLRSLGQYLTKDHSLCMNVERIDAMSNLRRLGISHAVEEIPTLEEHKCLRSLLLFNNKNFKSMHKDIFRKLEHIRVLVLSGTSIKDIPDSVGNLVLLRLLDLSYTEINKLPESIGSLISLEYLSLLGCRQLDSLPAGLMRLSNISFLHLEQTSIDHVPKGIAKFQQLYNLRGVFESGTGFRLDELRCLPNIQRLWVSKLEEAMPGSELVLKNSRNLKELGLRCTMKMGTHDRTRYEHDKVWKIQQVYDMLVPSPSLEYIFLVGFPGTMFPEWLRSKPELNMPSLRQMHLDECISCSELPPAGQMPQLQFLKIKGADAIESIGEELLGKEAGSPAAIFPKLEVLQVIRMFSLRSWSLNTGNPSDSSQHISLMPCLKRLLLLDCPKLRALPRDMSNIVNLKRIHIEGAHKLQEVVDLPAVTWLKVKNNTRLRTISNLCKLQDLLAQDCPALDQAKNLCSLRRL

HMMPfam: PF00931
IPR002182
119-391 NB-ARC,NBS
NB-ARC

DMVQMIVSSCRENRSSVFGIQGMGGIGKTTLAQKIYNEPLVREKFQVRIWLCISQSYTETGLIKQAIRMAGEKCDQLETKTELLPLLVDSIKGKSVLLVLDDVWKSDVWIDLFLSPFKRALNFHVLVTTRDLDVLAEMHATYTHQVNTMNYHDGLELLMKKSFQPYEQISEFKNVGYEIVKKCDGLPLAIKVVAGVLSTKRTTAEWKSIRDSKWSIHGLPKELGGPLYLSYSSLPPQLKECFLWCALLPPNFEIHRDSVAYWWVAEGLVRKEH

Gene3D: G3DSA:3.40.50.300
130-255 G3DSA:3.40.50.300

ENRSSVFGIQGMGGIGKTTLAQKIYNEPLVREKFQVRIWLCISQSYTETGLIKQAIRMAGEKCDQLETKTELLPLLVDSIKGKSVLLVLDDVWKSDVWIDLFLSPFKRALNFHVLVTTRDLDVLAE

superfamily: SSF52540
131-330 SSF52540

NRSSVFGIQGMGGIGKTTLAQKIYNEPLVREKFQVRIWLCISQSYTETGLIKQAIRMAGEKCDQLETKTELLPLLVDSIKGKSVLLVLDDVWKSDVWIDLFLSPFKRALNFHVLVTTRDLDVLAEMHATYTHQVNTMNYHDGLELLMKKSFQPYEQISEFKNVGYEIVKKCDGLPLAIKVVAGVLSTKRTTAEWKSIRDS

FPrintScan: PR00364
IPR000767
135-150 DISEASERSIST
Disease resistance protein

VFGIQGMGGIGKTTLA

FPrintScan: PR00364
IPR000767
208-222 DISEASERSIST
Disease resistance protein

SIKGKSVLLVLDDVW

FPrintScan: PR00364
IPR000767
301-315 DISEASERSIST
Disease resistance protein

CDGLPLAIKVVAGVL

superfamily: SSF52058
425-920 SSF52058,LRR

TMHDLLRSLGQYLTKDHSLCMNVERIDAMSNLRRLGISHAVEEIPTLEEHKCLRSLLLFNNKNFKSMHKDIFRKLEHIRVLVLSGTSIKDIPDSVGNLVLLRLLDLSYTEINKLPESIGSLISLEYLSLLGCRQLDSLPAGLMRLSNISFLHLEQTSIDHVPKGIAKFQQLYNLRGVFESGTGFRLDELRCLPNIQRLWVSKLEEAMPGSELVLKNSRNLKELGLRCTMKMGTHDRTRYEHDKVWKIQQVYDMLVPSPSLEYIFLVGFPGTMFPEWLRSKPELNMPSLRQMHLDECISCSELPPAGQMPQLQFLKIKGADAIESIGEELLGKEAGSPAAIFPKLEVLQVIRMFSLRSWSLNTGNPSDSSQHISLMPCLKRLLLLDCPKLRALPRDMSNIVNLKRIHIEGAHKLQEVVDLPAVTWLKVKNNTRLRTISNLCKLQDLLAQDCPALDQAKNLCSLRRLYMVDCPHEQEFRKCLSEEQGVLVHVATVGAD

Gene3D: G3DSA:3.80.10.10
452-650 G3DSA:3.80.10.10

AMSNLRRLGISHAVEEIPTLEEHKCLRSLLLFNNKNFKSMHKDIFRKLEHIRVLVLSGTSIKDIPDSVGNLVLLRLLDLSYTEINKLPESIGSLISLEYLSLLGCRQLDSLPAGLMRLSNISFLHLEQTSIDHVPKGIAKFQQLYNLRGVFESGTGFRLDELRCLPNIQRLWVSKLEEAMPGSELVLKNSRNLKELGLR

HMMPfam: PF13855
477-535 LRR_8,Leucine rich repeat

LRSLLLFNNKNFKSMHKDIFRKLEHIRVLVLSGTSIKDIPDSVGNLVLLRLLDLSYTEI

FPrintScan: PR00364
IPR000767
543-559 DISEASERSIST
Disease resistance protein

GSLISLEYLSLLGCRQL

Gene3D: G3DSA:3.80.10.10
706-904 G3DSA:3.80.10.10

ELNMPSLRQMHLDECISCSELPPAGQMPQLQFLKIKGADAIESIGEELLGKEAGSPAAIFPKLEVLQVIRMFSLRSWSLNTGNPSDSSQHISLMPCLKRLLLLDCPKLRALPRDMSNIVNLKRIHIEGAHKLQEVVDLPAVTWLKVKNNTRLRTISNLCKLQDLLAQDCPALDQAKNLCSLRRLYMVDCPHEQEFRKCL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox