PRGDB00047301 (rga S-L8)

From PRG Wiki
Jump to: navigation, search
rga S-L8
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 28555908 (AJ507098)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Hordeum vulgare

Comment?

Hordeum vulgare mRNA for NBS-LRR disease resistance protein homologue (rga S-L8 gene).

DNA Sequence

ATGGCGGAGGCGGTGCTTGTTGCTCTCGGAAAGATTGGGAATGTTTTAGCTGATGAAGCTACCAAAGCTTTGCTGGCCAAGCTGTCAGAAAAAGTTAGTAATCTGATTGATCTGGATGACAAGATTGAGGGAATAGCGAAGCAATTAAAAACCATGAACAATGTCATACAGCAGATAGGCACGCCGTACCTTGCCGACAAAGTCGTAAAGGGTTGGATTGGGGAGGTGAGGAAGTTGGCCTACCATGTCGAGGATGTGATGGACAAATACTCGTATCACTCTCTTCATGTCGAAAAAGGGTTTCTGAAGAAGTGCCTCAAAGGATCACATTATGTCCGGGTTTTCAGTCAAATTGCTGACGAGGTAGTCAAGATTGAGAAGGAGATCAAGCAAGTTATCGAACTCAAGGAGCAGTGGCTCCAACCATCCCAGCTTGTTCATGACCCTCTCACTGAGATGGAAAGACAACGGTCCCAAGATAGCTTCCCTGAACTTGTGAAAGATGAAGATCTTATTGGAATTGAAGATAACAGGCGAATGATGACTGAATGGTTGTACTCGGATGAGATGGAGACTACAGTGATAACTGTGTCAGGTATGGGTGGGTTGGGAAAGACAACCCTCGTCACAAATGTGTATGAACGTGAAAAGGTCAACTTCCAAACTAGTGCATGGATGGTTGTGTCTCAGACCTACACTTTGGATGCTCTGTTGAGGAAGTTACTCGAGAAGGTTACTGAACAACCATCATCACCTAACATTGACAGGATGGATGTGCATGACTTGAAGGAAGAAATAAAGCGAAAGCTTAAAGATAGGAAATGTTTAATTGTATTGGATGATGTCTGGAACAAGGAAGTGTACTCTCAAATGCGAGATGCATTCCACAATTCTCATGCAAGCCGCGTCATCATCACGACGCGGAACAATCATGTTGCTGCTGTTGCCCACTCGACACGTCGTATCGATCTCAAGCCTTTGGGGAATGCTCACGCATTCGAACTCTTCTGCAGGAGGGTCTTTTATATCAAGAAGGACCATGTGTATGAGTGTCCCAATCATCTCATGAAAACTGCTAGGTCTATAGTTGATAGGTGTCAGGGTCTGCCACTAGCAATTTTATCTATAGGCGGTCTTTTGTCTTCGAGGCCACAAACACAATACTCTTGGGAGCAGATATTCAATCAACTCTCAACTGAGCTGTCGAACAATGATAATCTCCGGGCAGTTTTAAATCTGAGCTACCATGACCTATCTGGAGACCTCAGAAACTGCCTTTTGTATTGCAGCCTCTTCCCGGAAGACTACCCAATGTCACGTGAGAGCCTTGTGAGGCTGTGGGTTGCAGAAGGCTTTGTGTGTAGCAAAGGAAATAGCACCCCGGAGGAGGTGGCCGAGGGAAACCTCATGGAACTGATATACCGCAACATGCTTGAAGTCAAGGAGACAGATGAACTGGGAAGGGTGAGCACCTGTACGATGCATGATATCGTGCGAGACCTGGCTCTTTGTGTTGCGAGCGAGGAGCAGTTTGTATGCGCAAATGATTATGCCACATTGATACATATGAATAAGGATGTTCGTCGTCTGTCATCATGCGGGTGGAAAGGCAATACTGCACTGAAAATTAAGCTTCCCCGTCTTCGAACTCTAGTGTCAGTAGGAGCAATTTCATCCACGCCTGCCATGCCATTCTCGCTTTCATCAGAGTCCAACTACCTGACTGTCCTCGAGCTACAGGACTCTGAAATCACTGAAGTGCCGGCATGGATAGGGACACTCTTCAATTTACGTTACATTGGCTTACGCCGCACCAAGGTCAGGTCACTCCCGGACTCTGTTGAGAAACTATCGAACCTGCAAACTCTGGACATCAAGCAAACTAACATAGAGACCCTACCAAAAGGGATTGTTAAGATCAAGAATCTACGGCACCTCTTGGCTGATAGATATGCTGATGAGAAGCAGTCGGAGTTTCGATACTTTATCGGAATTCAAGCCCCAAAAGCACTGCCCAACATGGGAGAATTGCAGACCCTTGAGACCATCCAAGCCAGCAAAGACTTGGCCGAGCAGCTGGAGAGAATGGTGCAACTGCGAACTCTGTGGATTGACAACATAAGTTCTGCTGAATGCGCAAATATTTTTACCGCCCTATCAAACATGCCGCTTCTTTCCAGCCTGCTTCTTGCTGGAAGAGATGAGAATGAGGCGCTTTGTTTCGAGTCCCTCCAGCCAATGTCCACACATCTCCACAAGCTGATCATCAGAGGGAAATGGGCCAAGGGAACACTGAACTGCCCGATATTTCGCAGCCACGGAGAAAATCTCAAGTATCTAGCTCTAAGCTGGTGTCACCTTTGGGAAGACGAGGATCCACTAGGGATGCTTGCACCACACTTGCCGAACCTCACGTATCTGCGACTCAACAACATGCGTAGTGCAAACATTTTGGTTCTTTCTGCAGATTCCTTTCCTCACCTGAAGAGTCTTACACTAAAGCACATGCATAATGTCAACGAGCTAAAGATCATTGATGGCGCCCTTCCGTGCATCGAAGGTTTGTATGTTGTGTCGTTGTCGAAGCTGGATAAGGTCCCTCAAGGCATTGAATCCCTTAGCTCCCTGAAGAAGCTCTGGTTGGTGGGCTTGCATGGGGGCTTCAAAACTCAGTGGGACAAGAACGGAATGCAGCAGAAGATGGTGCATGTTCAGGAGGTTCGTGTCTGA


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein homologue NBS-LRR disease resistance protein homologue [Hordeum vulgare].

MAEAVLVALGKIGNVLADEATKALLAKLSEKVSNLIDLDDKIEGIAKQLKTMNNVIQQIGTPYLADKVVKGWIGEVRKLAYHVEDVMDKYSYHSLHVEKGFLKKCLKGSHYVRVFSQIADEVVKIEKEIKQVIELKEQWLQPSQLVHDPLTEMERQRSQDSFPELVKDEDLIGIEDNRRMMTEWLYSDEMETTVITVSGMGGLGKTTLVTNVYEREKVNFQTSAWMVVSQTYTLDALLRKLLEKVTEQPSSPNIDRMDVHDLKEEIKRKLKDRKCLIVLDDVWNKEVYSQMRDAFHNSHASRVIITTRNNHVAAVAHSTRRIDLKPLGNAHAFELFCRRVFYIKKDHVYECPNHLMKTARSIVDRCQGLPLAILSIGGLLSSRPQTQYSWEQIFNQLSTELSNNDNLRAVLNLSYHDLSGDLRNCLLYCSLFPEDYPMSRESLVRLWVAEGFVCSKGNSTPEEVAEGNLMELIYRNMLEVKETDELGRVSTCTMHDIVRDLALCVASEEQFVCANDYATLIHMNKDVRRLSSCGWKGNTALKIKLPRLRTLVSVGAISSTPAMPFSLSSESNYLTVLELQDSEITEVPAWIGTLFNLRYIGLRRTKVRSLPDSVEKLSNLQTLDIKQTNIETLPKGIVKIKNLRHLLADRYADEKQSEFRYFIGIQAPKALPNMGELQTLETIQASKDLAEQLERMVQLRTLWIDNISSAECANIFTALSNMPLLSSLLLAGRDENEALCFESLQPMSTHLHKLIIRGKWAKGTLNCPIFRSHGENLKYLALSWCHLWEDEDPLGMLAPHLPNLTYLRLNNMRSANILVLSADSFPHLKSLTLKHMHNVNELKIIDGALPCIEGLYVVSLSKLDKVPQGIESLSSLKKLWLVGLHGGFKTQWDKNGMQQKMVHVQEVRV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
10-909 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GKIGNVLADEATKALLAKLSEKVSNLIDLDDKIEGIAKQLKTMNNVIQQIGTPYLADKVVKGWIGEVRKLAYHVEDVMDKYSYHSLHVEKGFLKKCLKGSHYVRVFSQIADEVVKIEKEIKQVIELKEQWLQPSQLVHDPLTEMERQRSQDSFPELVKDEDLIGIEDNRRMMTEWLYSDEMETTVITVSGMGGLGKTTLVTNVYEREKVNFQTSAWMVVSQTYTLDALLRKLLEKVTEQPSSPNIDRMDVHDLKEEIKRKLKDRKCLIVLDDVWNKEVYSQMRDAFHNSHASRVIITTRNNHVAAVAHSTRRIDLKPLGNAHAFELFCRRVFYIKKDHVYECPNHLMKTARSIVDRCQGLPLAILSIGGLLSSRPQTQYSWEQIFNQLSTELSNNDNLRAVLNLSYHDLSGDLRNCLLYCSLFPEDYPMSRESLVRLWVAEGFVCSKGNSTPEEVAEGNLMELIYRNMLEVKETDELGRVSTCTMHDIVRDLALCVASEEQFVCANDYATLIHMNKDVRRLSSCGWKGNTALKIKLPRLRTLVSVGAISSTPAMPFSLSSESNYLTVLELQDSEITEVPAWIGTLFNLRYIGLRRTKVRSLPDSVEKLSNLQTLDIKQTNIETLPKGIVKIKNLRHLLADRYADEKQSEFRYFIGIQAPKALPNMGELQTLETIQASKDLAEQLERMVQLRTLWIDNISSAECANIFTALSNMPLLSSLLLAGRDENEALCFESLQPMSTHLHKLIIRGKWAKGTLNCPIFRSHGENLKYLALSWCHLWEDEDPLGMLAPHLPNLTYLRLNNMRSANILVLSADSFPHLKSLTLKHMHNVNELKIIDGALPCIEGLYVVSLSKLDKVPQGIESLSSLKKLWLVGLHGGFKTQWDKNGMQQKMVHVQEVRV

HMMPanther: PTHR23155:SF197
10-909 PTHR23155:SF197,OS11G0227100 PROTEIN

GKIGNVLADEATKALLAKLSEKVSNLIDLDDKIEGIAKQLKTMNNVIQQIGTPYLADKVVKGWIGEVRKLAYHVEDVMDKYSYHSLHVEKGFLKKCLKGSHYVRVFSQIADEVVKIEKEIKQVIELKEQWLQPSQLVHDPLTEMERQRSQDSFPELVKDEDLIGIEDNRRMMTEWLYSDEMETTVITVSGMGGLGKTTLVTNVYEREKVNFQTSAWMVVSQTYTLDALLRKLLEKVTEQPSSPNIDRMDVHDLKEEIKRKLKDRKCLIVLDDVWNKEVYSQMRDAFHNSHASRVIITTRNNHVAAVAHSTRRIDLKPLGNAHAFELFCRRVFYIKKDHVYECPNHLMKTARSIVDRCQGLPLAILSIGGLLSSRPQTQYSWEQIFNQLSTELSNNDNLRAVLNLSYHDLSGDLRNCLLYCSLFPEDYPMSRESLVRLWVAEGFVCSKGNSTPEEVAEGNLMELIYRNMLEVKETDELGRVSTCTMHDIVRDLALCVASEEQFVCANDYATLIHMNKDVRRLSSCGWKGNTALKIKLPRLRTLVSVGAISSTPAMPFSLSSESNYLTVLELQDSEITEVPAWIGTLFNLRYIGLRRTKVRSLPDSVEKLSNLQTLDIKQTNIETLPKGIVKIKNLRHLLADRYADEKQSEFRYFIGIQAPKALPNMGELQTLETIQASKDLAEQLERMVQLRTLWIDNISSAECANIFTALSNMPLLSSLLLAGRDENEALCFESLQPMSTHLHKLIIRGKWAKGTLNCPIFRSHGENLKYLALSWCHLWEDEDPLGMLAPHLPNLTYLRLNNMRSANILVLSADSFPHLKSLTLKHMHNVNELKIIDGALPCIEGLYVVSLSKLDKVPQGIESLSSLKKLWLVGLHGGFKTQWDKNGMQQKMVHVQEVRV

superfamily: SSF52540
154-404 SSF52540

ERQRSQDSFPELVKDEDLIGIEDNRRMMTEWLYSDEMETTVITVSGMGGLGKTTLVTNVYEREKVNFQTSAWMVVSQTYTLDALLRKLLEKVTEQPSSPNIDRMDVHDLKEEIKRKLKDRKCLIVLDDVWNKEVYSQMRDAFHNSHASRVIITTRNNHVAAVAHSTRRIDLKPLGNAHAFELFCRRVFYIKKDHVYECPNHLMKTARSIVDRCQGLPLAILSIGGLLSSRPQTQYSWEQIFNQLSTELSNN

Gene3D: G3DSA:3.40.50.300
178-309 G3DSA:3.40.50.300

RRMMTEWLYSDEMETTVITVSGMGGLGKTTLVTNVYEREKVNFQTSAWMVVSQTYTLDALLRKLLEKVTEQPSSPNIDRMDVHDLKEEIKRKLKDRKCLIVLDDVWNKEVYSQMRDAFHNSHASRVIITTRN

HMMPfam: PF00931
IPR002182
179-455 NB-ARC,NBS
NB-ARC

RMMTEWLYSDEMETTVITVSGMGGLGKTTLVTNVYEREKVNFQTSAWMVVSQTYTLDALLRKLLEKVTEQPSSPNIDRMDVHDLKEEIKRKLKDRKCLIVLDDVWNKEVYSQMRDAFHNSHASRVIITTRNNHVAAVAHSTRRIDLKPLGNAHAFELFCRRVFYIKKDHVYECPNHLMKTARSIVDRCQGLPLAILSIGGLLSSRPQTQYSWEQIFNQLSTELSNNDNLRAVLNLSYHDLSGDLRNCLLYCSLFPEDYPMSRESLVRLWVAEGFVCS

FPrintScan: PR00364
IPR000767
194-209 DISEASERSIST
Disease resistance protein

VITVSGMGGLGKTTLV

FPrintScan: PR00364
IPR000767
269-283 DISEASERSIST
Disease resistance protein

KLKDRKCLIVLDDVW

FPrintScan: PR00364
IPR000767
366-380 DISEASERSIST
Disease resistance protein

CQGLPLAILSIGGLL

superfamily: SSF52058
477-903 SSF52058,LRR

MLEVKETDELGRVSTCTMHDIVRDLALCVASEEQFVCANDYATLIHMNKDVRRLSSCGWKGNTALKIKLPRLRTLVSVGAISSTPAMPFSLSSESNYLTVLELQDSEITEVPAWIGTLFNLRYIGLRRTKVRSLPDSVEKLSNLQTLDIKQTNIETLPKGIVKIKNLRHLLADRYADEKQSEFRYFIGIQAPKALPNMGELQTLETIQASKDLAEQLERMVQLRTLWIDNISSAECANIFTALSNMPLLSSLLLAGRDENEALCFESLQPMSTHLHKLIIRGKWAKGTLNCPIFRSHGENLKYLALSWCHLWEDEDPLGMLAPHLPNLTYLRLNNMRSANILVLSADSFPHLKSLTLKHMHNVNELKIIDGALPCIEGLYVVSLSKLDKVPQGIESLSSLKKLWLVGLHGGFKTQWDKNGMQQKMVH

Gene3D: G3DSA:3.80.10.10
572-646 G3DSA:3.80.10.10

NYLTVLELQDSEITEVPAWIGTLFNLRYIGLRRTKVRSLPDSVEKLSNLQTLDIKQTNIETLPKGIVKIKNLRHL

HMMPfam: PF13855
596-647 LRR_8,Leucine rich repeat

NLRYIGLRRTKVRSLPDSVEKLSNLQTLDIKQTNIETLPKGIVKIKNLRHLL

FPrintScan: PR00364
IPR000767
615-631 DISEASERSIST
Disease resistance protein

EKLSNLQTLDIKQTNIE

Gene3D: G3DSA:3.80.10.10
684-883 G3DSA:3.80.10.10

QASKDLAEQLERMVQLRTLWIDNISSAECANIFTALSNMPLLSSLLLAGRDENEALCFESLQPMSTHLHKLIIRGKWAKGTLNCPIFRSHGENLKYLALSWCHLWEDEDPLGMLAPHLPNLTYLRLNNMRSANILVLSADSFPHLKSLTLKHMHNVNELKIIDGALPCIEGLYVVSLSKLDKVPQGIESLSSLKKLWLVG


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox