PRGDB00047303 (rga S-9204)

From PRG Wiki
Jump to: navigation, search
rga S-9204
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 28555903 (AJ507096)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Hordeum vulgare

Comment?

Hordeum vulgare mRNA for NBS-LRR disease resistance protein homologue (rga S-9204 gene).

DNA Sequence

ATGGCTGAGTCTGCTGTTAAAGCCGTGGTCGGGAATGTGAGCAAACTTGCGGTTCATGAGACCTCATTTTTATGTGGTGTCACTAGTGAAGTAGGATTCTTGAAAGATGAACTGAAGCGGTTAAAGTGCTACCTTAGATCTGCTGATGCTAAACGGAAATCAGGAGATGAGTGTGTGGCTACGTGGCTCAGCCAGATCAGGGACGTGACATATGAGTCCGAGAATGTCATTGAAGCTGCAGATTACATGGGGAAGAAAAACAGGCTGAAGAATGGATTCTTGGGTGCCATTTCAAGGTATGCTCGCTTGCCAAGTGACATGGTTACCCTTCATAACGTTGGTGTCGATATCCTACGTATAAGAAGGAAGATCAGCGAGATATTTGACAGTGCAAACCGTTTGAATATTGATTTGGATACTGGTGTTCTAGGCAAGTGCTGTGCCGAGGATGAGTTTCCACGAGTAAATGATCTCATGGATCAAAACTTTGAGGATAATGTTGCCATTGTCGGTTTTGAGGATGAGTACCAAGAAATAACGGACAAGTTAGTTGACAAAGAGAACAATACTCTTAGTGCTATCTCCATAGTTGCCATGGGTGGAGCGGGAAAAACATCACTAGTTAGAAAAATCTACACTTCATCAAGAGTAAAAGAACATTTCGACACAGCTGCTTGGGTGACTGTGTCTCAAAAGTTCAAGGCCGTTGATTTACTAACAAGTATTATGGAACAAATAATGGGGGGCAGAGTTGGTTTTAATATCCGTCAGTGTGAGGTGGGAAAGGAGATACATGATTTTCTGTTGCAAAAAAGATTCTTAGTAGTTCTTGATGATGTTTGGGAAACAGATACATGGGAGCAAATAAACAAAATGGTTAAAGCATTTCCAGATGTAGCCAATGGTAGTCGAGTACTGTTAACCACACGAAAGCAAGATGTTGCGAATCATGTGCAAATGCCAACTCATGTCCATCATCTGAAGAAGTTAGACGAAGAGAAAAGTTGGGAACTTTTTAGTAGCAAAGCTTTACCACCATACAACAGGTCTGCTGTATGTGATGTGGATGAGTTTGAAGAACTAGGAAAGAAGCTTGCTAGGAAATGTAATGGATTACCGCTTGCACTTGCAGTTTTTGGGGGTTATCTGTCAAAAAATCTGAACAAGGAAACATGGATCGATATACTCTCGAGCTGGCCATCAACCAAAGACGGACAGATGATGCGAGACATACTAGCTCGCAGTTACAATGACCTACCAGATCATTATTTAAAATCATGTTTCCTCTATGTTGCTGCTTTCCCCGAGGATTATGAAATATCTGTGTCGGATCTTATTGAGTTATGGATAGCAGAATGCTTCATTCCACATACACCAAAACATACACTGGAAGAAATAGCACGTAAGTATGTAACTGAGTTAGCTCAAAGAAGCTTGGTCCAAGTTGTTAATAGAAGCAGAGCACATGGATGGATTGAAAGAATAAGGATCCATGATATCTTGCGTGACTGGTGCATAGAAGAAGCAAGAGAAGACGGCTTTCTTGATATGATCGACAAAACTGCATGCTGGGATGGTGCATCATCATCTGATAACATGATATCCTATCGTGCTTCATTCCAAAACTTCAGTGGTCAGATTTTACAGGCAACAACTCCTAATCTACGAACTCTGGTTGGCTTTGAACTTTCATCAATATTCCTACCTAAGCTGAGATTCCTGAGAGTTCTTCACATTGAAAACTCAGACCTTGAGAATTTATCTCCAGCCATTGGTGGGTGCATCCACCTAAGATGCCTTAGGTTGAGAAGATGTGGAAATGTAACACTCCCTTCAATTGGAGAACTCCTTTACTTGCAGATTATAGACCTGAGGAAAACAAACTTGGACTCAACAGTACCAAACTCTCTTTGGAATATTCCCACTCTAAGGCATGTTTACCTGAGCAGTGGATTTTCTTCACCAAGGTGTGTGGGACACAAAGAGCTCCAGACCTTATGGTTGACTTGCGCATCTGTTGGTACCAAATATCGCTATCATGACATGGTGACGTTTTTGAGAAAAATGAGACAACTGACAACCTTGTTCTTGGTAATGAAGCCCATGCATGCAAATATAATGAATATATTTGCATACATGCCTCACCTGGTTGATATTCATCTATCTTGTTTTGGTGTGCTTGATAAGCTTCCAGACAGTAATCACTTCCCGCAGAGCCTTCGGCAACTCTATCTAGAAGCTGGTGTCATTGAAATAGACCCGATGCCGATCCTGGAGAAGCTTCCCTGTCTCGTGGTATTGGAGTTATCAGGGTATAAAGGCCGAACCATGACGTTTTCCGCCCAAGGGTTTCCTCGTCTACAAGAGTTAAAACTTGATAATTTCTCCGTCGATGAGTGGAGGATGGAGGTAGGACCAATGCCAAAGCTCTCCCACCTGAAGCTTTGGTTGTGCAAGGAGATGTTGAAGTTACCCAACGGACTGTTGCATCTTCCATCCCCCAAGAATTTGAAACTAGTCAGCAAGTCCCCAATTTTTAGAGATGACAGCACAGTGAAGGAGCTGGAGCGGAGAGGATGCAAGGTGGAACTTTAA


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein homologue NBS-LRR disease resistance protein homologue [Hordeum vulgare].

MAESAVKAVVGNVSKLAVHETSFLCGVTSEVGFLKDELKRLKCYLRSADAKRKSGDECVATWLSQIRDVTYESENVIEAADYMGKKNRLKNGFLGAISRYARLPSDMVTLHNVGVDILRIRRKISEIFDSANRLNIDLDTGVLGKCCAEDEFPRVNDLMDQNFEDNVAIVGFEDEYQEITDKLVDKENNTLSAISIVAMGGAGKTSLVRKIYTSSRVKEHFDTAAWVTVSQKFKAVDLLTSIMEQIMGGRVGFNIRQCEVGKEIHDFLLQKRFLVVLDDVWETDTWEQINKMVKAFPDVANGSRVLLTTRKQDVANHVQMPTHVHHLKKLDEEKSWELFSSKALPPYNRSAVCDVDEFEELGKKLARKCNGLPLALAVFGGYLSKNLNKETWIDILSSWPSTKDGQMMRDILARSYNDLPDHYLKSCFLYVAAFPEDYEISVSDLIELWIAECFIPHTPKHTLEEIARKYVTELAQRSLVQVVNRSRAHGWIERIRIHDILRDWCIEEAREDGFLDMIDKTACWDGASSSDNMISYRASFQNFSGQILQATTPNLRTLVGFELSSIFLPKLRFLRVLHIENSDLENLSPAIGGCIHLRCLRLRRCGNVTLPSIGELLYLQIIDLRKTNLDSTVPNSLWNIPTLRHVYLSSGFSSPRCVGHKELQTLWLTCASVGTKYRYHDMVTFLRKMRQLTTLFLVMKPMHANIMNIFAYMPHLVDIHLSCFGVLDKLPDSNHFPQSLRQLYLEAGVIEIDPMPILEKLPCLVVLELSGYKGRTMTFSAQGFPRLQELKLDNFSVDEWRMEVGPMPKLSHLKLWLCKEMLKLPNGLLHLPSPKNLKLVSKSPIFRDDSTVKELERRGCKVEL

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
152-385 SSF52540

FPRVNDLMDQNFEDNVAIVGFEDEYQEITDKLVDKENNTLSAISIVAMGGAGKTSLVRKIYTSSRVKEHFDTAAWVTVSQKFKAVDLLTSIMEQIMGGRVGFNIRQCEVGKEIHDFLLQKRFLVVLDDVWETDTWEQINKMVKAFPDVANGSRVLLTTRKQDVANHVQMPTHVHHLKKLDEEKSWELFSSKALPPYNRSAVCDVDEFEELGKKLARKCNGLPLALAVFGGYLSK

Gene3D: G3DSA:3.40.50.300
171-316 G3DSA:3.40.50.300

GFEDEYQEITDKLVDKENNTLSAISIVAMGGAGKTSLVRKIYTSSRVKEHFDTAAWVTVSQKFKAVDLLTSIMEQIMGGRVGFNIRQCEVGKEIHDFLLQKRFLVVLDDVWETDTWEQINKMVKAFPDVANGSRVLLTTRKQDVAN

HMMPfam: PF00931
IPR002182
173-456 NB-ARC,NBS
NB-ARC

EDEYQEITDKLVDKENNTLSAISIVAMGGAGKTSLVRKIYTSSRVKEHFDTAAWVTVSQKFKAVDLLTSIMEQIMGGRVGFNIRQCEVGKEIHDFLLQKRFLVVLDDVWETDTWEQINKMVKAFPDVANGSRVLLTTRKQDVANHVQMPTHVHHLKKLDEEKSWELFSSKALPPYNRSAVCDVDEFEELGKKLARKCNGLPLALAVFGGYLSKNLNKETWIDILSSWPSTKDGQMMRDILARSYNDLPDHYLKSCFLYVAAFPEDYEISVSDLIELWIAECFIP

FPrintScan: PR00364
IPR000767
193-208 DISEASERSIST
Disease resistance protein

AISIVAMGGAGKTSLV

HMMPanther: PTHR11017
194-654 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ISIVAMGGAGKTSLVRKIYTSSRVKEHFDTAAWVTVSQKFKAVDLLTSIMEQIMGGRVGFNIRQCEVGKEIHDFLLQKRFLVVLDDVWETDTWEQINKMVKAFPDVANGSRVLLTTRKQDVANHVQMPTHVHHLKKLDEEKSWELFSSKALPPYNRSAVCDVDEFEELGKKLARKCNGLPLALAVFGGYLSKNLNKETWIDILSSWPSTKDGQMMRDILARSYNDLPDHYLKSCFLYVAAFPEDYEISVSDLIELWIAECFIPHTPKHTLEEIARKYVTELAQRSLVQVVNRSRAHGWIERIRIHDILRDWCIEEAREDGFLDMIDKTACWDGASSSDNMISYRASFQNFSGQILQATTPNLRTLVGFELSSIFLPKLRFLRVLHIENSDLENLSPAIGGCIHLRCLRLRRCGNVTLPSIGELLYLQIIDLRKTNLDSTVPNSLWNIPTLRHVYLSSGFSS

FPrintScan: PR00364
IPR000767
267-281 DISEASERSIST
Disease resistance protein

FLLQKRFLVVLDDVW

FPrintScan: PR00364
IPR000767
369-383 DISEASERSIST
Disease resistance protein

CNGLPLALAVFGGYL

superfamily: SSF52058
523-841 SSF52058,LRR

CWDGASSSDNMISYRASFQNFSGQILQATTPNLRTLVGFELSSIFLPKLRFLRVLHIENSDLENLSPAIGGCIHLRCLRLRRCGNVTLPSIGELLYLQIIDLRKTNLDSTVPNSLWNIPTLRHVYLSSGFSSPRCVGHKELQTLWLTCASVGTKYRYHDMVTFLRKMRQLTTLFLVMKPMHANIMNIFAYMPHLVDIHLSCFGVLDKLPDSNHFPQSLRQLYLEAGVIEIDPMPILEKLPCLVVLELSGYKGRTMTFSAQGFPRLQELKLDNFSVDEWRMEVGPMPKLSHLKLWLCKEMLKLPNGLLHLPSPKNLKLVS

Gene3D: G3DSA:3.80.10.10
562-839 G3DSA:3.80.10.10

ELSSIFLPKLRFLRVLHIENSDLENLSPAIGGCIHLRCLRLRRCGNVTLPSIGELLYLQIIDLRKTNLDSTVPNSLWNIPTLRHVYLSSGFSSPRCVGHKELQTLWLTCASVGTKYRYHDMVTFLRKMRQLTTLFLVMKPMHANIMNIFAYMPHLVDIHLSCFGVLDKLPDSNHFPQSLRQLYLEAGVIEIDPMPILEKLPCLVVLELSGYKGRTMTFSAQGFPRLQELKLDNFSVDEWRMEVGPMPKLSHLKLWLCKEMLKLPNGLLHLPSPKNLKL

FPrintScan: PR00364
IPR000767
759-775 DISEASERSIST
Disease resistance protein

EKLPCLVVLELSGYKGR


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox