PRGDB00047306 (rga S-9201)

From PRG Wiki
Jump to: navigation, search
rga S-9201
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 28555893 (AJ507093)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Hordeum vulgare

Comment?

Hordeum vulgare mRNA for NBS-LRR disease resistance protein homologue (rga S-9201 gene).

DNA Sequence

ATGGCGCATGTAGCCGGGTTGCTCGCCTCGGCTGTGGTCTCAGCAGTGGGCAATAAGCTAGGTTCCGCCATTGGGGATGAGGTCACGATGCTGTGGAGCTTCAAGGACGACCTCAAGGACATGAAGGACACGTTGGAGTCCATGGAGGCGGTGCTCAAGGATGCTGAGAGGCGGTCTGTCAAGGAGGAGTTGGTGCGGTTGTGGCTCAACCGGCTCAAGCACGCTGCCTATGACATCTCTTATATGCTCGATGAGTTCCAGGCTAACAGTGAACCAGCCTCCAGAAAGATGATTGGGAAGCTGGACTGTTTTGCTATTGCACCCAAGATTACCTTGGCTTATAAGATGAAGAAGATGAGAGGTCAGCTGAGGAAGATCAAAGAGGACCACGAGAGTTTCAAATTCACACACGCTAACTCGAGCCTAATTAATGTGCACCAGCTTCCTGATCCACGGGAAACATCTTCAAATGTGGTTGAATCACTCATCATAGGGAGAGAGAAAGACAGGATGAATGTCCTATCCTTGTTATCCACAAGCAACAACATCAAAGAAGATTTCACAGTTCTTCCAATCTGTGGGCTTGGAGGCATAGGAAAGACAACTTTGGCACAACTGGTCTTCAATGATGCTCAATTCAATGATTATCATCGGGTATGGGTCTATGTATCACAGGTATTTGACTTGAATAAAATAGGGAACTCCATAATTTCTCAAGTATCGGGAAAAGGGAGTGAGCATTCTCATACACTGCAGCACATAAGCAAACAACTTAAAGATCTACTTCAAGATAAGAAGACTTTAATTGTTTTAGATGACCTATGGGAAACAGGTTACTTTCAACTTGATCAACTCAAGCTTATGTTGAATGTTAGCACCAAGATGAAAGTGTTAGTCACAACACGCAGCATAGACATTGCAAGAAAAATGGGTAATGTTGGCGTTGAACCATACATGCTAGATCCTTTGGACAATGACATGTGCTGGAGAATAATCAAGCAAAGTAGTAGATTTCAATCTAGGCCTGATAAAGAGCAACTTGAACCAAATGGACAGAAGATTGCAAGGAAATGTGGAGGTTTGCCACTAGCAGCTCAAGCACTTGGATTCTTGCTTTCTGGAATGGATCTTAGTGAGTGGGAAGCAATTTGCATTAGTGATATTTGGGATGAACCATTTTCTGATAGTACAGTGTTGCCATCCTTGAAGTTAAGTTACAATACTTTGACACCATATATGAGGTTATGCTTTGCCTATTGTGGTATCTTTCCTAAAGGTCACAATATAAGTAAAGATTATCTTATCCATCAATGGATTGCTCTGGGTTTCATCGAGCCATCTAATAAGTTTTCGGCCATACAACTTGGCGGGAAGTATGTTAGGCAATTCCTGGGGATGTCTTTCCTTCATCATTCAAAATTGCCCGAGACATTTGGAAATGCAATGTTCACCATGCATGATCTGGTTCATGATCTCGCAAGATCGGTCATTACTGAAGAGTTGGTTGTCTTTGATGCTGAAATAGTGAGCGATAATAGAATAAAAGAATACTGCATCTATGCGTCTCTCACAAATTGCAATATTTCAGATCACAACAAGGTGAGAAAGATGACAACTATTTTCCCACCCAAGTTAAGGGTGATGCATTTTTCGGATTGTAAATTGCATGGCAGTGCATTTTCATTTCAAAAGTGCTTGCGAGTCTTGGATCTATCTGGATGCTCCATCAAGGATTTTGCAAGCGCTCTAGGACAACTGAAGCAACTGGAGGTTCTTATTGCTCAAAAGCTACAAGATCGGCAATTTCCTGAGAGTATCACTCGCCTCTCGAAATTACATTACCTGAACCTCAGTGGATCACGTGGAATTTCAGAAATACCAAGCTCGGTTGGCAAACTTGTGAGTTTGGTGCATCTTGACTTGTCTTATTGTACCAATGTCAAAGTCATACCGAAGGCTCTTGGAATCCTCAGAAACCTTCAAACACTAGATCTCTCATGGTGCGAGAAACTAGAGTCCCTTCCAGAGAGCCTTGGAAGCGTACAAAACCTTCAAAGACTCAACCTCTCAAACTGCTTTGAACTAGAGGCCCTTCCAGAGAGCCTTGGAAGCCTAAAAGACGTTCAAACTCTCGATCTCTCAAGTTGTTATAAACTAGAGTCTCTTCCAGAGAGCCTTGGAAGCCTAAAAAACGTTCAAACTCTCGATCTCTCAAGATGTTATAAACTAGTGTCTCTTCCAAAGAACCTTGGAAGACTCAAAAACCTTCGAACAATCGACCTCTCAGGCTGCAAGAAACTAGAGACTTTTCCAGAGAGCTTTGGAAGCCTTGAAAACCTTCAAATACTCAACCTCTCAAATTGCTTTGAACTAGAGTCCCTTCCAGAGAGCTTTGGAAGCCTCAAAAACCTTCAAACACTAAACCTAGTTGAGTGCAAGAAACTAGAGTCCCTTCCAGAGAGCCTTGGAGGCCTCAAAAACCTTCAAACACTCGACTTCTCCGTCTGCCATAAACTAGAGTCCGTTCCAGAGAGCCTTGGAGGCCTCAACAACCTTCAAACACTCAAACTCTCAGTTTGTGATAATCTAGTGTCCCTTCTGAAGAGCCTTGGAAGCCTTAAAAACCTTCAAACACTCGACCTCTCAGGCTGCAAGAAACTAGAATCTCTTCCAGAGAGCCTTGGAAGCCTTGAAAACCTTCAAATACTCAATCTCTCAAACTGCTTTAAACTAGAGTCCCTTCCAGAGAGCCTTGGTAGACTTAAAAACCTTCAAACACTCAACATCTCATGGTGCACTGAACTAGTGTTCCTTCCGAAGAACCTTGGAAACCTAAAAAACCTTCCAAGACTCGACCTCTCAGGCTGCATGAAATTAGAGTCTCTTCCTGACAGCCTTGGAAGCCTCGAAAACCTTGAAACACTCAACCTCTCAAAATGCTTTAAACTAGAGTCCCTTCCAGAGAGCCTTGGAGGCCTCCAAAACCTTCAAACACTCGACCTCTTAGTCTGCCATAAACTAGAGTCCCTTCCGGAGAGCCTTGGAGGCCTAAAAAACCTCCAAACACTCCAACTCTCATTCTGTCATAAACTCGAGTCCCTTCCGGAGAGCCTTGGAGGCCTAAAAAACCTTCAAACACTGACACTCTCAGTGTGCGATAAACTAGAGTCCCTTCCAGAAAGCCTTGGAAGCCTCAAAAACCTACATACACTCAAACTCCAAGTCTGCTATAAACTAAAGTCCCTTCCAGAGAGCCTTGGAAGCATCAAAAACCTTCATACACTTAATCTCTCAGTCTGCCATAATCTAGAGTCCATTCCGGAGAGCGTTGGAAGCCTCGAAAACCTTCAAATACTCAACCTTTCAAACTGCTTTAAACTAGAGTCCATTCCAAAGAGCCTTGGAAGCCTAAAAAACCTTCAAACACTCATCCTCTCATGGTGCACTAGACTAGTGTCACTTCCGAAGAACCTTGGAAATCTAAAAAACCTTCAAACACTCGACCTCTCAGGCTGCAAGAAACTAGAGTCTCTACCAGATAGCCTTGGAAGCCTCGAAAACCTTCAAACACTCAACCTCTCAAACTGCTTTAAACTAGAATCCCTTCCAGAGATCCTTGGAAGCCTCAAAAAGCTTCAAACACTCAACCTCTTCCGATGCGGGAAATTAGAGTCCCTTCCAGAGAGCCTTGGAAGCCTAAAACACCTTCAAACACTCGTCCTCATAGATTGTCCTAAACTAGAGTACCTTCCGAAGAGCCTTGAAAACCTGTCTGGAAACCGTTTTTAG


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein homologue NBS-LRR disease resistance protein homologue [Hordeum vulgare].

MAHVAGLLASAVVSAVGNKLGSAIGDEVTMLWSFKDDLKDMKDTLESMEAVLKDAERRSVKEELVRLWLNRLKHAAYDISYMLDEFQANSEPASRKMIGKLDCFAIAPKITLAYKMKKMRGQLRKIKEDHESFKFTHANSSLINVHQLPDPRETSSNVVESLIIGREKDRMNVLSLLSTSNNIKEDFTVLPICGLGGIGKTTLAQLVFNDAQFNDYHRVWVYVSQVFDLNKIGNSIISQVSGKGSEHSHTLQHISKQLKDLLQDKKTLIVLDDLWETGYFQLDQLKLMLNVSTKMKVLVTTRSIDIARKMGNVGVEPYMLDPLDNDMCWRIIKQSSRFQSRPDKEQLEPNGQKIARKCGGLPLAAQALGFLLSGMDLSEWEAICISDIWDEPFSDSTVLPSLKLSYNTLTPYMRLCFAYCGIFPKGHNISKDYLIHQWIALGFIEPSNKFSAIQLGGKYVRQFLGMSFLHHSKLPETFGNAMFTMHDLVHDLARSVITEELVVFDAEIVSDNRIKEYCIYASLTNCNISDHNKVRKMTTIFPPKLRVMHFSDCKLHGSAFSFQKCLRVLDLSGCSIKDFASALGQLKQLEVLIAQKLQDRQFPESITRLSKLHYLNLSGSRGISEIPSSVGKLVSLVHLDLSYCTNVKVIPKALGILRNLQTLDLSWCEKLESLPESLGSVQNLQRLNLSNCFELEALPESLGSLKDVQTLDLSSCYKLESLPESLGSLKNVQTLDLSRCYKLVSLPKNLGRLKNLRTIDLSGCKKLETFPESFGSLENLQILNLSNCFELESLPESFGSLKNLQTLNLVECKKLESLPESLGGLKNLQTLDFSVCHKLESVPESLGGLNNLQTLKLSVCDNLVSLLKSLGSLKNLQTLDLSGCKKLESLPESLGSLENLQILNLSNCFKLESLPESLGRLKNLQTLNISWCTELVFLPKNLGNLKNLPRLDLSGCMKLESLPDSLGSLENLETLNLSKCFKLESLPESLGGLQNLQTLDLLVCHKLESLPESLGGLKNLQTLQLSFCHKLESLPESLGGLKNLQTLTLSVCDKLESLPESLGSLKNLHTLKLQVCYKLKSLPESLGSIKNLHTLNLSVCHNLESIPESVGSLENLQILNLSNCFKLESIPKSLGSLKNLQTLILSWCTRLVSLPKNLGNLKNLQTLDLSGCKKLESLPDSLGSLENLQTLNLSNCFKLESLPEILGSLKKLQTLNLFRCGKLESLPESLGSLKHLQTLVLIDCPKLEYLPKSLENLSGNRF

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
16-1258 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VGNKLGSAIGDEVTMLWSFKDDLKDMKDTLESMEAVLKDAERRSVKEELVRLWLNRLKHAAYDISYMLDEFQANSEPASRKMIGKLDCFAIAPKITLAYKMKKMRGQLRKIKEDHESFKFTHANSSLINVHQLPDPRETSSNVVESLIIGREKDRMNVLSLLSTSNNIKEDFTVLPICGLGGIGKTTLAQLVFNDAQFNDYHRVWVYVSQVFDLNKIGNSIISQVSGKGSEHSHTLQHISKQLKDLLQDKKTLIVLDDLWETGYFQLDQLKLMLNVSTKMKVLVTTRSIDIARKMGNVGVEPYMLDPLDNDMCWRIIKQSSRFQSRPDKEQLEPNGQKIARKCGGLPLAAQALGFLLSGMDLSEWEAICISDIWDEPFSDSTVLPSLKLSYNTLTPYMRLCFAYCGIFPKGHNISKDYLIHQWIALGFIEPSNKFSAIQLGGKYVRQFLGMSFLHHSKLPETFGNAMFTMHDLVHDLARSVITEELVVFDAEIVSDNRIKEYCIYASLTNCNISDHNKVRKMTTIFPPKLRVMHFSDCKLHGSAFSFQKCLRVLDLSGCSIKDFASALGQLKQLEVLIAQKLQDRQFPESITRLSKLHYLNLSGSRGISEIPSSVGKLVSLVHLDLSYCTNVKVIPKALGILRNLQTLDLSWCEKLESLPESLGSVQNLQRLNLSNCFELEALPESLGSLKDVQTLDLSSCYKLESLPESLGSLKNVQTLDLSRCYKLVSLPKNLGRLKNLRTIDLSGCKKLETFPESFGSLENLQILNLSNCFELESLPESFGSLKNLQTLNLVECKKLESLPESLGGLKNLQTLDFSVCHKLESVPESLGGLNNLQTLKLSVCDNLVSLLKSLGSLKNLQTLDLSGCKKLESLPESLGSLENLQILNLSNCFKLESLPESLGRLKNLQTLNISWCTELVFLPKNLGNLKNLPRLDLSGCMKLESLPDSLGSLENLETLNLSKCFKLESLPESLGGLQNLQTLDLLVCHKLESLPESLGGLKNLQTLQLSFCHKLESLPESLGGLKNLQTLTLSVCDKLESLPESLGSLKNLHTLKLQVCYKLKSLPESLGSIKNLHTLNLSVCHNLESIPESVGSLENLQILNLSNCFKLESIPKSLGSLKNLQTLILSWCTRLVSLPKNLGNLKNLQTLDLSGCKKLESLPDSLGSLENLQTLNLSNCFKLESLPEILGSLKKLQTLNLFRCGKLESLPESLGSLKHLQTLVLIDCPKLEYLPKSLENLS

superfamily: SSF52540
146-390 SSF52540

HQLPDPRETSSNVVESLIIGREKDRMNVLSLLSTSNNIKEDFTVLPICGLGGIGKTTLAQLVFNDAQFNDYHRVWVYVSQVFDLNKIGNSIISQVSGKGSEHSHTLQHISKQLKDLLQDKKTLIVLDDLWETGYFQLDQLKLMLNVSTKMKVLVTTRSIDIARKMGNVGVEPYMLDPLDNDMCWRIIKQSSRFQSRPDKEQLEPNGQKIARKCGGLPLAAQALGFLLSGMDLSEWEAICISDIWD

Gene3D: G3DSA:3.40.50.300
168-310 G3DSA:3.40.50.300

KDRMNVLSLLSTSNNIKEDFTVLPICGLGGIGKTTLAQLVFNDAQFNDYHRVWVYVSQVFDLNKIGNSIISQVSGKGSEHSHTLQHISKQLKDLLQDKKTLIVLDDLWETGYFQLDQLKLMLNVSTKMKVLVTTRSIDIARKM

HMMPfam: PF00931
IPR002182
172-448 NB-ARC,NBS
NB-ARC

NVLSLLSTSNNIKEDFTVLPICGLGGIGKTTLAQLVFNDAQFNDYHRVWVYVSQVFDLNKIGNSIISQVSGKGSEHSHTLQHISKQLKDLLQDKKTLIVLDDLWETGYFQLDQLKLMLNVSTKMKVLVTTRSIDIARKMGNVGVEPYMLDPLDNDMCWRIIKQSSRFQSRPDKEQLEPNGQKIARKCGGLPLAAQALGFLLSGMDLSEWEAICISDIWDEPFSDSTVLPSLKLSYNTLTPYMRLCFAYCGIFPKGHNISKDYLIHQWIALGFIEPSN

FPrintScan: PR00364
IPR000767
189-204 DISEASERSIST
Disease resistance protein

VLPICGLGGIGKTTLA

FPrintScan: PR00364
IPR000767
261-275 DISEASERSIST
Disease resistance protein

LLQDKKTLIVLDDLW

FPrintScan: PR00364
IPR000767
358-372 DISEASERSIST
Disease resistance protein

CGGLPLAAQALGFLL

Gene3D: G3DSA:3.80.10.10
516-707 G3DSA:3.80.10.10

EYCIYASLTNCNISDHNKVRKMTTIFPPKLRVMHFSDCKLHGSAFSFQKCLRVLDLSGCSIKDFASALGQLKQLEVLIAQKLQDRQFPESITRLSKLHYLNLSGSRGISEIPSSVGKLVSLVHLDLSYCTNVKVIPKALGILRNLQTLDLSWCEKLESLPESLGSVQNLQRLNLSNCFELEALPESLGSLKD

superfamily: SSF52058
518-815 SSF52058,LRR

CIYASLTNCNISDHNKVRKMTTIFPPKLRVMHFSDCKLHGSAFSFQKCLRVLDLSGCSIKDFASALGQLKQLEVLIAQKLQDRQFPESITRLSKLHYLNLSGSRGISEIPSSVGKLVSLVHLDLSYCTNVKVIPKALGILRNLQTLDLSWCEKLESLPESLGSVQNLQRLNLSNCFELEALPESLGSLKDVQTLDLSSCYKLESLPESLGSLKNVQTLDLSRCYKLVSLPKNLGRLKNLRTIDLSGCKKLETFPESFGSLENLQILNLSNCFELESLPESFGSLKNLQTLNLVECKKL

HMMPfam: PF13516
564-585 LRR_6,Leucine Rich repeat

KCLRVLDLSGCSIKDFASALGQ

HMMPfam: PF00560
IPR001611
635-653 LRR_1
Leucine-rich repeat

SLVHLDLSYCTNVKVIPKA

HMMPfam: PF00560
IPR001611
659-680 LRR_1
Leucine-rich repeat

NLQTLDLSWCEKLESLPESLGS

HMMPfam: PF13855
683-740 LRR_8,Leucine rich repeat

NLQRLNLSNCFELEALPESLGSLKDVQTLDLSSCYKLESLPESLGSLKNVQTLDLSRC

Gene3D: G3DSA:3.80.10.10
708-851 G3DSA:3.80.10.10

VQTLDLSSCYKLESLPESLGSLKNVQTLDLSRCYKLVSLPKNLGRLKNLRTIDLSGCKKLETFPESFGSLENLQILNLSNCFELESLPESFGSLKNLQTLNLVECKKLESLPESLGGLKNLQTLDFSVCHKLESVPESLGGLNN

HMMPfam: PF13855
755-811 LRR_8,Leucine rich repeat

NLRTIDLSGCKKLETFPESFGSLENLQILNLSNCFELESLPESFGSLKNLQTLNLVE

superfamily: SSF52058
817-1009 SSF52058,LRR

SLPESLGGLKNLQTLDFSVCHKLESVPESLGGLNNLQTLKLSVCDNLVSLLKSLGSLKNLQTLDLSGCKKLESLPESLGSLENLQILNLSNCFKLESLPESLGRLKNLQTLNISWCTELVFLPKNLGNLKNLPRLDLSGCMKLESLPDSLGSLENLETLNLSKCFKLESLPESLGGLQNLQTLDLLVCHKLES

Gene3D: G3DSA:3.80.10.10
852-1018 G3DSA:3.80.10.10

LQTLKLSVCDNLVSLLKSLGSLKNLQTLDLSGCKKLESLPESLGSLENLQILNLSNCFKLESLPESLGRLKNLQTLNISWCTELVFLPKNLGNLKNLPRLDLSGCMKLESLPDSLGSLENLETLNLSKCFKLESLPESLGGLQNLQTLDLLVCHKLESLPESLGGLK

FPrintScan: PR00364
IPR000767
871-887 DISEASERSIST
Disease resistance protein

GSLKNLQTLDLSGCKKL

HMMPfam: PF13855
875-932 LRR_8,Leucine rich repeat

NLQTLDLSGCKKLESLPESLGSLENLQILNLSNCFKLESLPESLGRLKNLQTLNISWC

HMMPfam: PF00560
IPR001611
948-969 LRR_1
Leucine-rich repeat

LPRLDLSGCMKLESLPDSLGSL

superfamily: SSF52058
958-1259 SSF52058,LRR

KLESLPDSLGSLENLETLNLSKCFKLESLPESLGGLQNLQTLDLLVCHKLESLPESLGGLKNLQTLQLSFCHKLESLPESLGGLKNLQTLTLSVCDKLESLPESLGSLKNLHTLKLQVCYKLKSLPESLGSIKNLHTLNLSVCHNLESIPESVGSLENLQILNLSNCFKLESIPKSLGSLKNLQTLILSWCTRLVSLPKNLGNLKNLQTLDLSGCKKLESLPDSLGSLENLQTLNLSNCFKLESLPEILGSLKKLQTLNLFRCGKLESLPESLGSLKHLQTLVLIDCPKLEYLPKSLENLSG

HMMPfam: PF13855
970-1029 LRR_8,Leucine rich repeat

ENLETLNLSKCFKLESLPESLGGLQNLQTLDLLVCHKLESLPESLGGLKNLQTLQLSFCH

Gene3D: G3DSA:3.80.10.10
1019-1251 G3DSA:3.80.10.10

NLQTLQLSFCHKLESLPESLGGLKNLQTLTLSVCDKLESLPESLGSLKNLHTLKLQVCYKLKSLPESLGSIKNLHTLNLSVCHNLESIPESVGSLENLQILNLSNCFKLESIPKSLGSLKNLQTLILSWCTRLVSLPKNLGNLKNLQTLDLSGCKKLESLPDSLGSLENLQTLNLSNCFKLESLPEILGSLKKLQTLNLFRCGKLESLPESLGSLKHLQTLVLIDCPKLEYLP

HMMPfam: PF00560
IPR001611
1115-1137 LRR_1
Leucine-rich repeat

NLQILNLSNCFKLESIPKSLGSL

HMMPfam: PF00560
IPR001611
1139-1161 LRR_1
Leucine-rich repeat

NLQTLILSWCTRLVSLPKNLGNL

HMMPfam: PF12799
1162-1204 LRR_4,Leucine Rich repeats (2 copies)

KNLQTLDLSGCKKLESLPDSLGSLENLQTLNLSNCFKLESLPE

HMMPfam: PF00560
IPR001611
1211-1233 LRR_1
Leucine-rich repeat

KLQTLNLFRCGKLESLPESLGSL


List of References

L H Madsen, N C Collins, M Rakwalska, G Backes, N Sandal, L Krusell, J Jensen, E H Waterman, A Jahoor, M Ayliffe, A J Pryor, P Langridge, P Schulze-Lefert, J Stougaard
Barley disease resistance gene analogs of the NBS-LRR class: identification and mapping.
Mol. Genet. Genomics: 2003, 269(1);150-61
PubMed:12715163 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox