PRGDB00047308 (rga S-226)

From PRG Wiki
Jump to: navigation, search
rga S-226
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 28555888 (AJ507091)
Gene Class NL
Domain Type LRR, NBS, Others
Gene Species Hordeum vulgare

Comment?

Hordeum vulgare partial mRNA for NBS-LRR disease resistance protein homologue (rga S-226 gene).

DNA Sequence

ATGGACTTCGCCGTGGACGCGGCGCTGTGGGTGGTGGGCAAGGCGCTGGCCCCCGTCACGGGCGGCCTGCTGGAGTCATGGGCAGCCAGCACCGAGCTTGGCCGCAACATCGACGCCCTCAAGATGCAACTGCTGTACGCACAAGGGATGTTGGACAACGCGCAGGGTAGGGACATCCGCAGCCCTGCTCTCAAGGAGCTTCTGCACAAGCTGCGGGAGCTGGCGTACGGTGCCGACGACGCGCTCGACGAGCTCGACTACTTCCGCATCCAGGACGAGCTCGATGGCACATACCATGCCGCCGATTTGGATGCCCAGAACTGCGTTGACAGGCTAGCCATCAACGCTCGGCACACTGCCAAGGCTGCAGGCATTAAACTTAAGTGCTCGTCATCCTCTACCCGTGCTGATCCCGACGATCAGAAAGATGGTGGCACACGAGTATGCCTCTCTGTCGTTGGCTCGTGTGGTGGGCATGATATCAGCTCATCACCACCGCTACGCACCACCCAGGGAGTCCAAGAGGCTGATGGCGGATGCATGCCTAATGTCGTCTCTTGTGCTCGCAGCGCTGCAAAAACAATGGGTAAACACTTTCCGTGCCACTCTTTCCCGTCTGTGCATGATGATGACGCTGACGCCGTCATGCTGAAATCCTCCAATATGACAGGGAGTGGGCGACGATTCCTCTGTAGCGCCTGGCCATCAAAGGTGCTACAAGAAAATAACACCATGCAAACACAAAAACTGAAGTTTGATCGGGTCGTAATGTCTACAAAAATACTGGAAATTATAGAGCAGTTGAAACCTCTGTGTGCTATGGTCTCCACCATTCTCATTCTAGAACTACTTGGCTCCACCCATATCCCCACTGCCCAAGACATTACGAACCGACCCAAAACCACACCAAATATTATAGAGCCTGCGTTGTATGGGAGGAATGACCTGAAAAAGAACATCATTGATGGCATCACACATGGTAAATATTGTACCAATGAACTCACCGTAGTTCCACTTGTTGGTCCAGGAGGTATTGGGAAGACAACACTCACGCAAAACATATTTAGAGAACTGGAGGGTTCTTTCCAAGTTTCAGTTTGGGTATGTGTATCTCTCGACTTTAACGCAGAAAGGTTGACACAAGAGATTGTGAAAAAGATCCCTAAAGTGAATGATGAAAAGGATAATGCTACGAATCACGAGGTAATTGCACAAAGATTAAAATCTAAGCGGCTTTTACTTGTTTTACATGATGTGTGGACATACCATGAGGATGAGTGGAAAAAACTATTAGCTCCGTTAAATCAAACGGGGGGAGAGAAGGGTAATGTGGTTATAGTCACTACACGGATTCCAAAGGTAGCAAGTATGGTAACCACAACCAATTCTTCAATTGACGTGGAACGTCTAACTCATGAGGATACTATGTCTTTCTTCGAAGTATGTGTATTTGGTGACCAACAACCATGGAAAGATCATCCGGAATTACGTGATGTTGGGAGTAAAATAGTAAAAAAGTTGAAGGGTTTCCCTCTTGCAGCAAAAACAGTAGGTAGATTACTAAGAAACCACCTTACTTTGGACCACTGGACAAGAGTTGCAGAAAGTAAAGAATGGGAATTACATACCAATGACAATGACATTATGCCAGCTCTAAAGCTTAGTTATAATTACCTCCCTTTTCATCTACAACAGTGCTTTTCCTATTGTGGGTTGTTTCCAGAAGATTATGAATTTACTAGCAAGGAGTTGGTTCACTTTTGGATAGGATTAGGCATTATACGATCACTTGATCGGGCCAGAAGAACTGAAGATGTTGCACTATGCTATTTAAATGACTTGGTAAATCATGGATTTTTCAGAAAGAATGAGAAAGAAAATGGTCCTCATTATGTTATCCATGACCTACTGCATAACTTGGCGGTGATGGTTTCATCATATGAATGCCTTAGCATATATAGTTCTAACATGCAAACCATACAAATTCCTGCATCCGTGCGTCACTTGTCCATCATTGTAGATAATACTGATGTCAAAGATATAACCACTTTTAGAGAATACAACAGTTATTTGAGTGCACTTGGTAAAAGATTGAAAGTTCAGAACTTACGCACTTTAATTTTGTTTGGTGCATACCATGGAAGCTTTGCCAAAACTTTTAGGGGATTGTTTGAGGAAGCTAGAGCCTTACGCACTATATTCTTTTCTGGAGCATCATATTCTGTGGATGATGTGTTGCTGAACTTTTCAAAACTTGTCCATCTCCGCTACCTAAGGATCACATCTGTGCATAATAAGGACATGTGCTTACCTAGCGCATTGTTTAGATCGTATCACCTAGAGGTCATTGATCTAGAAAATTGGGGTGGCAGCTTTGGTTCAACAAGTCAAATGAGCAGCCTTATAAAACTGCGTCATTTCGTTGTGCCCCAATATAATCTTGAACTTTTCTCTAGCATATTCGAGGTTGGGAAAATAAAATTACTAGAGGAACTGAGAAGATTTGAAGTGAGAAAAGAAACTAAGGGTTTTGAGTTAAGTCAACTAGGAGAACTGACAGAGCTTGGAGGATCACTTGGCATTTATAATCTTGAAAATGTGCAGAAAAAGGACGAGGCAGACGAACTAAAACTAATGAACAAAAACCACTTGCACAAGCTAACACTAGAATGGTCTTTTGATAGACCCATCAGGGATGCAGAACAAGAAAAAAATGTGATTGAAAGTCTTGTCCCACACAGTAGTCTTCAAGACCTATGCATTAGAGGGCATGGAGGTGGTATTTGCCCATCATGGCTGGGCAGGTATCTCTCGGTCCAAAATTTAGAGTCACTTTCTCTGTGCAATGTATCTTGGAACACACTTCCGCCGCTTGGGGAGTTGAGGTTTATTGATGATCCTGATGAAGAGTGTAAGGGTCTTGTCTCAAGCCAAAGTTTCCTAATTTTGAAAAGACTAGAATTAGTTGAGATACCAAGACTAGCAAAATGGGTTGGAAATGGCAAATGTCATCTGTTCTCTGTTCTAGAGGTGGTCATCATACAAGATTGCCCTGAACTGGTAGAGTTGCCATTTTCTCACCCTAGTTGCCATCAAGCAAAGCAAGAGGATAACATGATTTGGTTTCCGAAACTAAGGGAGCTCAAGATTATACACTGCCCCAAATTGGCGTCATTGCCTGCAATTCCTTGGACAGAAGATCCATGCTCAGTTCAAATAGAACAAGCAGGATTAGTATTTGAGAAGCTTGTTTACTCGAGGAACTACGAATCAGAATTAAGTTTGGAAATTGAGGGAAAAGATGGTCAGCATAGCGTGTTTTGGAACGTGTTGGCTTTCCATAATCTAGCTGATCTGAAAGTGCTGAAGGTGAAGAACTGCCCTCCCCTGCCACTGATTCACCTCCAAAAGCTAAAATCTCTCAAGTCCCTCACGATAACCGGTATGAGCAACTCGTTGCTGCTGTTTGAATGTGAAAGCTATAATACTGAATGTCCACTTCCAGTTGAACAAATAAAGATCGATGAATGTGATGCTAATGGGAAGGAACTCACACAACTGTTAACTCATTTCCCAAAGATCACTAAGTTGGTAGTGAGCAGTTGTGAGAAGATAACAGAGATTGGTGCGGTGGAGCTTCAGACGGAAATGGCGACAGCATCATCTCCAGGTAATGAAATTGATATTGAGCATGCACAAGCAGAAGCAGGACACCATCAGACAAGAGGAGAGGAGGTAGAAGAAGCAGTGGCAGGAGGAGAAGGTCTCCTGCTCCTGCCTCGGCAACTAGAGAAGTTGATCATCTCTGGTTGCAGAGAGCTGCGGTTACTCTCCGATTCAATTGGCAAGGACAACACACACGGAGGAGGGCTCCAGAGTCTCTGCTCCATCCGCTCGTTGGACATATATGATTGCCCCAGGATCCTCTCATCCTACTCGTCCTCCACCTTATCTTGTTTCCCCTTCCCGGCCTCCCTCCAACAACTCGATCTGGGTGACGTGGAGGGCATGGAGACTCTGGCTCCCCTCTCAAATCTCATCTCTCTCACCAGTTTAACCATGTGTAATTGTGGGGATCTAAGAGGCGAGGGTTTATGGCCTCTCGTCGCCCAGGGCCGCCTCACAGAATTGCTCATCTTTGGAACTCGAAAATTCTTCACCGGTTCTGAGCCCTCACGGCTGCATGGCCAAGAGATTCCTTCATCCAAACTCGAACGTGTTTTTACAGATGACTTGACGGGAGTCCTTACTGCGCCCATCTGCAGACTCCTCTCTTCCTCCCTTACCGAATTAACCTTTTGTGAGAACCAAGAGGTGGAGCGCTTCACAGAGGAGCACGAGGAGGCCCTTCACCTCCTCAATTCTCTCCAGGAACTCTTTTTTCGGGATTGTGGGAAGCTGCAGCGCCTCCCTGCAGGGTTAGCCCGGCTTGCCAGCCTCAAGATATTACGGATTTGGTGGTGTCCAGCCATCAGGTCGCTGCCCAAGGACGGACTGCCAAGTTCTCTGCAAGAACTAGATATCAAAGTCTGTCCTGCCATCAAATCTCTGCCCAAGGACGGCCTGCCAAGTTCTCTACAAGAACTAGAGATCAGAAACTGCCCTGCCATCAAATCTCTGCCCAAGGACGGCCTGCCAAGTTCACTACGGAAATTAGAAGTTTGTGATGGCATCAGCGAGGAACTTAAAAGGCAGTGCCGCAAGTTAAAAGGAACCATTCCAATAATCATAGACTACTAA


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein homologue NBS-LRR disease resistance protein homologue [Hordeum vulgare].

MDFAVDAALWVVGKALAPVTGGLLESWAASTELGRNIDALKMQLLYAQGMLDNAQGRDIRSPALKELLHKLRELAYGADDALDELDYFRIQDELDGTYHAADLDAQNCVDRLAINARHTAKAAGIKLKCSSSSTRADPDDQKDGGTRVCLSVVGSCGGHDISSSPPLRTTQGVQEADGGCMPNVVSCARSAAKTMGKHFPCHSFPSVHDDDADAVMLKSSNMTGSGRRFLCSAWPSKVLQENNTMQTQKLKFDRVVMSTKILEIIEQLKPLCAMVSTILILELLGSTHIPTAQDITNRPKTTPNIIEPALYGRNDLKKNIIDGITHGKYCTNELTVVPLVGPGGIGKTTLTQNIFRELEGSFQVSVWVCVSLDFNAERLTQEIVKKIPKVNDEKDNATNHEVIAQRLKSKRLLLVLHDVWTYHEDEWKKLLAPLNQTGGEKGNVVIVTTRIPKVASMVTTTNSSIDVERLTHEDTMSFFEVCVFGDQQPWKDHPELRDVGSKIVKKLKGFPLAAKTVGRLLRNHLTLDHWTRVAESKEWELHTNDNDIMPALKLSYNYLPFHLQQCFSYCGLFPEDYEFTSKELVHFWIGLGIIRSLDRARRTEDVALCYLNDLVNHGFFRKNEKENGPHYVIHDLLHNLAVMVSSYECLSIYSSNMQTIQIPASVRHLSIIVDNTDVKDITTFREYNSYLSALGKRLKVQNLRTLILFGAYHGSFAKTFRGLFEEARALRTIFFSGASYSVDDVLLNFSKLVHLRYLRITSVHNKDMCLPSALFRSYHLEVIDLENWGGSFGSTSQMSSLIKLRHFVVPQYNLELFSSIFEVGKIKLLEELRRFEVRKETKGFELSQLGELTELGGSLGIYNLENVQKKDEADELKLMNKNHLHKLTLEWSFDRPIRDAEQEKNVIESLVPHSSLQDLCIRGHGGGICPSWLGRYLSVQNLESLSLCNVSWNTLPPLGELRFIDDPDEECKGLVSSQSFLILKRLELVEIPRLAKWVGNGKCHLFSVLEVVIIQDCPELVELPFSHPSCHQAKQEDNMIWFPKLRELKIIHCPKLASLPAIPWTEDPCSVQIEQAGLVFEKLVYSRNYESELSLEIEGKDGQHSVFWNVLAFHNLADLKVLKVKNCPPLPLIHLQKLKSLKSLTITGMSNSLLLFECESYNTECPLPVEQIKIDECDANGKELTQLLTHFPKITKLVVSSCEKITEIGAVELQTEMATASSPGNEIDIEHAQAEAGHHQTRGEEVEEAVAGGEGLLLLPRQLEKLIISGCRELRLLSDSIGKDNTHGGGLQSLCSIRSLDIYDCPRILSSYSSSTLSCFPFPASLQQLDLGDVEGMETLAPLSNLISLTSLTMCNCGDLRGEGLWPLVAQGRLTELLIFGTRKFFTGSEPSRLHGQEIPSSKLERVFTDDLTGVLTAPICRLLSSSLTELTFCENQEVERFTEEHEEALHLLNSLQELFFRDCGKLQRLPAGLARLASLKILRIWWCPAIRSLPKDGLPSSLQELDIKVCPAIKSLPKDGLPSSLQELEIRNCPAIKSLPKDGLPSSLRKLEVCDGISEELKRQCRKLKGTIPIIIDY

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
162-947 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SSSPPLRTTQGVQEADGGCMPNVVSCARSAAKTMGKHFPCHSFPSVHDDDADAVMLKSSNMTGSGRRFLCSAWPSKVLQENNTMQTQKLKFDRVVMSTKILEIIEQLKPLCAMVSTILILELLGSTHIPTAQDITNRPKTTPNIIEPALYGRNDLKKNIIDGITHGKYCTNELTVVPLVGPGGIGKTTLTQNIFRELEGSFQVSVWVCVSLDFNAERLTQEIVKKIPKVNDEKDNATNHEVIAQRLKSKRLLLVLHDVWTYHEDEWKKLLAPLNQTGGEKGNVVIVTTRIPKVASMVTTTNSSIDVERLTHEDTMSFFEVCVFGDQQPWKDHPELRDVGSKIVKKLKGFPLAAKTVGRLLRNHLTLDHWTRVAESKEWELHTNDNDIMPALKLSYNYLPFHLQQCFSYCGLFPEDYEFTSKELVHFWIGLGIIRSLDRARRTEDVALCYLNDLVNHGFFRKNEKENGPHYVIHDLLHNLAVMVSSYECLSIYSSNMQTIQIPASVRHLSIIVDNTDVKDITTFREYNSYLSALGKRLKVQNLRTLILFGAYHGSFAKTFRGLFEEARALRTIFFSGASYSVDDVLLNFSKLVHLRYLRITSVHNKDMCLPSALFRSYHLEVIDLENWGGSFGSTSQMSSLIKLRHFVVPQYNLELFSSIFEVGKIKLLEELRRFEVRKETKGFELSQLGELTELGGSLGIYNLENVQKKDEADELKLMNKNHLHKLTLEWSFDRPIRDAEQEKNVIESLVPHSSLQDLCIRGHGGGICPSWLGRYLSVQNLESLSL

HMMPanther: PTHR11017:SF28
162-947 PTHR11017:SF28

SSSPPLRTTQGVQEADGGCMPNVVSCARSAAKTMGKHFPCHSFPSVHDDDADAVMLKSSNMTGSGRRFLCSAWPSKVLQENNTMQTQKLKFDRVVMSTKILEIIEQLKPLCAMVSTILILELLGSTHIPTAQDITNRPKTTPNIIEPALYGRNDLKKNIIDGITHGKYCTNELTVVPLVGPGGIGKTTLTQNIFRELEGSFQVSVWVCVSLDFNAERLTQEIVKKIPKVNDEKDNATNHEVIAQRLKSKRLLLVLHDVWTYHEDEWKKLLAPLNQTGGEKGNVVIVTTRIPKVASMVTTTNSSIDVERLTHEDTMSFFEVCVFGDQQPWKDHPELRDVGSKIVKKLKGFPLAAKTVGRLLRNHLTLDHWTRVAESKEWELHTNDNDIMPALKLSYNYLPFHLQQCFSYCGLFPEDYEFTSKELVHFWIGLGIIRSLDRARRTEDVALCYLNDLVNHGFFRKNEKENGPHYVIHDLLHNLAVMVSSYECLSIYSSNMQTIQIPASVRHLSIIVDNTDVKDITTFREYNSYLSALGKRLKVQNLRTLILFGAYHGSFAKTFRGLFEEARALRTIFFSGASYSVDDVLLNFSKLVHLRYLRITSVHNKDMCLPSALFRSYHLEVIDLENWGGSFGSTSQMSSLIKLRHFVVPQYNLELFSSIFEVGKIKLLEELRRFEVRKETKGFELSQLGELTELGGSLGIYNLENVQKKDEADELKLMNKNHLHKLTLEWSFDRPIRDAEQEKNVIESLVPHSSLQDLCIRGHGGGICPSWLGRYLSVQNLESLSL

superfamily: SSF52540
293-544 SSF52540

QDITNRPKTTPNIIEPALYGRNDLKKNIIDGITHGKYCTNELTVVPLVGPGGIGKTTLTQNIFRELEGSFQVSVWVCVSLDFNAERLTQEIVKKIPKVNDEKDNATNHEVIAQRLKSKRLLLVLHDVWTYHEDEWKKLLAPLNQTGGEKGNVVIVTTRIPKVASMVTTTNSSIDVERLTHEDTMSFFEVCVFGDQQPWKDHPELRDVGSKIVKKLKGFPLAAKTVGRLLRNHLTLDHWTRVAESKEWELHTN

HMMPfam: PF00931
IPR002182
328-595 NB-ARC,NBS
NB-ARC

KYCTNELTVVPLVGPGGIGKTTLTQNIFRELEGSFQVSVWVCVSLDFNAERLTQEIVKKIPKVNDEKDNATNHEVIAQRLKSKRLLLVLHDVWTYHEDEWKKLLAPLNQTGGEKGNVVIVTTRIPKVASMVTTTNSSIDVERLTHEDTMSFFEVCVFGDQQPWKDHPELRDVGSKIVKKLKGFPLAAKTVGRLLRNHLTLDHWTRVAESKEWELHTNDNDIMPALKLSYNYLPFHLQQCFSYCGLFPEDYEFTSKELVHFWIGLGIIR

Gene3D: G3DSA:3.40.50.300
332-450 G3DSA:3.40.50.300

NELTVVPLVGPGGIGKTTLTQNIFRELEGSFQVSVWVCVSLDFNAERLTQEIVKKIPKVNDEKDNATNHEVIAQRLKSKRLLLVLHDVWTYHEDEWKKLLAPLNQTGGEKGNVVIVTTR

FPrintScan: PR00364
IPR000767
336-351 DISEASERSIST
Disease resistance protein

VVPLVGPGGIGKTTLT

FPrintScan: PR00364
IPR000767
406-420 DISEASERSIST
Disease resistance protein

RLKSKRLLLVLHDVW

FPrintScan: PR00364
IPR000767
507-521 DISEASERSIST
Disease resistance protein

LKGFPLAAKTVGRLL

superfamily: SSF52058
632-1203 SSF52058,LRR

VIHDLLHNLAVMVSSYECLSIYSSNMQTIQIPASVRHLSIIVDNTDVKDITTFREYNSYLSALGKRLKVQNLRTLILFGAYHGSFAKTFRGLFEEARALRTIFFSGASYSVDDVLLNFSKLVHLRYLRITSVHNKDMCLPSALFRSYHLEVIDLENWGGSFGSTSQMSSLIKLRHFVVPQYNLELFSSIFEVGKIKLLEELRRFEVRKETKGFELSQLGELTELGGSLGIYNLENVQKKDEADELKLMNKNHLHKLTLEWSFDRPIRDAEQEKNVIESLVPHSSLQDLCIRGHGGGICPSWLGRYLSVQNLESLSLCNVSWNTLPPLGELRFIDDPDEECKGLVSSQSFLILKRLELVEIPRLAKWVGNGKCHLFSVLEVVIIQDCPELVELPFSHPSCHQAKQEDNMIWFPKLRELKIIHCPKLASLPAIPWTEDPCSVQIEQAGLVFEKLVYSRNYESELSLEIEGKDGQHSVFWNVLAFHNLADLKVLKVKNCPPLPLIHLQKLKSLKSLTITGMSNSLLLFECESYNTECPLPVEQIKIDECDANGKELTQLLTHFPKITKLVVSSCE

Gene3D: G3DSA:3.80.10.10
689-852 G3DSA:3.80.10.10

SYLSALGKRLKVQNLRTLILFGAYHGSFAKTFRGLFEEARALRTIFFSGASYSVDDVLLNFSKLVHLRYLRITSVHNKDMCLPSALFRSYHLEVIDLENWGGSFGSTSQMSSLIKLRHFVVPQYNLELFSSIFEVGKIKLLEELRRFEVRKETKGFELSQLGEL

Gene3D: G3DSA:3.80.10.10
914-949 G3DSA:3.80.10.10

SSLQDLCIRGHGGGICPSWLGRYLSVQNLESLSLCN

Gene3D: G3DSA:3.80.10.10
996-1064 G3DSA:3.80.10.10

KWVGNGKCHLFSVLEVVIIQDCPELVELPFSHPSCHQAKQEDNMIWFPKLRELKIIHCPKLASLPAIPW

FPrintScan: PR00364
IPR000767
1114-1130 DISEASERSIST
Disease resistance protein

HNLADLKVLKVKNCPPL

Gene3D: G3DSA:3.80.10.10
1115-1217 G3DSA:3.80.10.10

NLADLKVLKVKNCPPLPLIHLQKLKSLKSLTITGMSNSLLLFECESYNTECPLPVEQIKIDECDANGKELTQLLTHFPKITKLVVSSCEKITEIGAVELQTEM

Gene3D: G3DSA:3.80.10.10
1261-1267 G3DSA:3.80.10.10

RQLEKLI

Gene3D: G3DSA:3.80.10.10
1268-1379 G3DSA:3.80.10.10

ISGCRELRLLSDSIGKDNTHGGGLQSLCSIRSLDIYDCPRILSSYSSSTLSCFPFPASLQQLDLGDVEGMETLAPLSNLISLTSLTMCNCGDLRGEGLWPLVAQGRLTELLI

superfamily: SSF52058
1291-1556 SSF52058,LRR

LQSLCSIRSLDIYDCPRILSSYSSSTLSCFPFPASLQQLDLGDVEGMETLAPLSNLISLTSLTMCNCGDLRGEGLWPLVAQGRLTELLIFGTRKFFTGSEPSRLHGQEIPSSKLERVFTDDLTGVLTAPICRLLSSSLTELTFCENQEVERFTEEHEEALHLLNSLQELFFRDCGKLQRLPAGLARLASLKILRIWWCPAIRSLPKDGLPSSLQELDIKVCPAIKSLPKDGLPSSLQELEIRNCPAIKSLPKDGLPSSLRKLEVCD

Gene3D: G3DSA:3.80.10.10
1421-1555 G3DSA:3.80.10.10

CRLLSSSLTELTFCENQEVERFTEEHEEALHLLNSLQELFFRDCGKLQRLPAGLARLASLKILRIWWCPAIRSLPKDGLPSSLQELDIKVCPAIKSLPKDGLPSSLQELEIRNCPAIKSLPKDGLPSSLRKLEVC


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox