PRGDB00047309 (rga S-217)

From PRG Wiki
Jump to: navigation, search
rga S-217
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 28555886 (AJ507090)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Hordeum vulgare

Comment?

Hordeum vulgare partial mRNA for NBS-LRR disease resistance protein homologue (rga S-217 gene).

DNA Sequence

GGTGGTTGACGCAGCAATAGGATGGCTGGTGCAAACCATCCTTGGGAGCTACTTCACTGAACAGATTGAAGCCTGCACTCGTGAAATTGGGCTTGCTGAAGATGTGGAGAAGCTTAAATTTGAGATGAGAAACGTGGAGATGGTTCTTGCTGCTGCCGAGGGAAGGAGGATTGAAAACAAGCCTCTGGCAAGCTCACTGGATTTTCTCAAAGAGCTGCTTTATGACTCAGAGGATGTGATGGACGAGCTCGATTACTATCGACTCCAGCAGCAGATCGAAAAAGGGAAAGGTACTGCTCCTAGTGGTGTTAATCCTGAGGGAAGCTACGTGTTCTCATCAGCTCCATCTTCTGCTTTTGAATTAGTATGCAGTGCCACAAGCCAAATGACTAGTTGGGCCTCAAGCAGCAGAAAAAGGAAGCATGAAGAGGAGGGGCCAGTTCAAAGTACTATGCTGACTTATGAGATTAAGCATGACATTTCTCAGAGGATCAACGGAATAGTGAAAGGTTTATGCACTATTGGCAGTTCCGTGCAGAGAGTTCTTCAACTTGAGGTCTCGCGCCCCACTGCAACATCACTTGAGAGTCAGAATATTTCCAATAATGCTCGGCTGACAACTTCTGTTCCAGTTGAAGTTAAGATGTATGGAAGGGAATCGGAGAGAGACAAGATAATAGAGCTGTTGATAGAGGGGGGTTCTAGTGATCTGAATGTTTTGCCAGTGGTTGGCATTGGTGGTGTTGGGAAGACAACTCTTGCTAGATTTGTATGCAAGGACCAAAGAATTAGAGATCATTTTGATCTGCAAATGTGGGTTTGTGTATCCACTGACTTCAATGAAGTGAGGCTAACACATGAGATCCTAGAGCATGTATGTGAAAATAGCCAAGAATATGAAAATATAAGCAATTTCAATGTACTGCAGAAGAACCTTTTGAAGAATATCAGAAACAAAAGATTTCTGCTTGTATTGGATGACATGTGGGAAGACAAGGACATGAGTGGATGGATTAAATTCTTGGCTCCATTGAAAGGTAATCAAGCAAGTGGTTGCATGATACTAGCAACAACTAGAATGGATTCAGTTGCAAAAATGATACAAACGATGGATAAAGTCAGATTGAGTGGCCTGAATGAAGAGGAGTTTTGGCTGTTATTCAAGGCATGTGCATTTGGTAACGAGAACTATGAGGGTGATCCTGGTTTACAGTCTATTGGGAAACAGATTGTTAAAGCACTAAAGGGCTGCCCACTAGCCGCACAAAGTGTTGGTGCACTTTTGAACACAAGTGTTAGCGATAAGCATTGGAGGGCAGTTCGTGACAAATGGAGATCTCTTCAAGAAGATGCTAATGATATTTTACCCGTCTTGAAGCTTAGTTATGATTATCTCCCAGTCCACCTTCAACACTGTTTCTCGTACTGCTCTTTATATCCAGAGGACAAACATTTTGATGGGACAGAATTGGTCCATGCTTGGGTATCACAGAATTTTGTGCAGTGTGAAGACCCTACGGTGAAATTGGAAGAAACAGGGCAGCAATATTTGGATAGATTAGTTGATTTGTGCTTCTTCCAAAAGGTTGGCTCACGTTATGTTATGCATGATCTAATGCATGAATTGGCAGGGAAAGTTTCATCAAATGAATGTGCTACTATACATGGATTGAAACATGAGGCAATTCGACCGAGTGTTCGCCATTTGTCAGTCATAACTACTGCTTTTGATAAAGATAAACCTGACAGTTTTCCTAATGAGAAGTTTGATAAAATACTTGAGAAGGTTGGGCCTTCGCAAAAATTGAGGACTTTGATGTTTTTTGGGCGAAGCAGCATAAATTTATTAGAGTCCTTGCGTACTTTATGCAGGAAGGCAAACTGTTTACGGTTCCTAAGAATTTATGTGAGAGATGCTGACATGAGCTCTATACACAGTTTGTTCAATCCACACCATCTTCGCTATCTTGAATATATTCCTGTTGTCATTACAGATAGATCGTCATATAGAGTCTACAACAACACTGTGTTTCCTCAAGCATTGACAAGATTTTATCACCTTCAAGTATGGAATATGGGTATTTCAGGCAATTTTGCTGTGCCTACTGATATGCATAATCTTGTTAATTTGCGCCATCTTATTTCTCATGAGAAAGTGCATCATGCAATAGCCTGTGTCGGAAACATGACCTCTCTTCAGGGACTAAGTTTCAAGGTTCAAAATATCGGTAGTTTTGAGATAAGAGAACTTCAGTCCCTGAATGAGCTTGTACTACTTGAAATTTCTCAACTTGAAAATGTGAAGACCAAAGAAGAGGCCAGTGGGGCCAGGCTATTAGACAAAGAGTATCTAGAAACATTGTCCTTGTCATGGCAGGATAACAGCACGAGCCTTCAGATAGAGACAGCAAAGGATGTGCTTGAAGGTCTTCAACCACATCAGGACCTCAAAACTCTAAAAATAACTGGATACGGTGGTGCTACCTCCCCAACCTGGCTTTCTAATACTTCCCCAGTCACCTTGGTGCAGATACTTCATCTAGAGAAGTGCAGGGAATGGAAAATTCTTCCAGCTCCTGCAATGCTTCCTTTCCTTAGGAAGCTGACATTGATCAGAATGTTGAATTTAACTGAAATCTCAGTTCCTTCCTTGGAAGAGTTGATCTTGATCGGTATGCCAGAATTGAAGAAATGTACCGGTTCTTATGGAACGGAATTGACCTCCCGTTTAAGGGTTTTGATGATCAAGAACTGCCCTGAACTGAATGAGCTCACTCTTTTTCGGAGTTACTCTTCTTTTAATGCTGAACAGAAATCATGGTTTCCGTCTCTCAGCAAACTCTCCATCGGGCAGTGTCCTCATATATTGAACGACTGGCCAATCCTTCCACTAATTGAAATGAAGGCACTCAATGAGTTAGAGTTGATGGACCTGCATGTTGTCAGAGTGTCAGTTCCTTCTCTGGAGAAGTTGGTGTTGATTAAAATGCCAAACCTGGAATTTTGCAGCAGTGTAACGACCCAAGGAGATCAAATGGGATTGCCATCTAGTCTGCGTAGACTTACCATCCGTGATTGCCCTTGTTTGGTAGTGTCACATCCTCTGCCGCCTTCTGCTTTGATTTCCGAGATGTCCATCAGGGGAGTTCCGGGACTTGCAGAAATGAGGATAAACCATAGACAGTTCACTATCGAATCTAATGAGTTGTGTGTGCTGGATGGGAGTATCTTGGCATTTCATAATCTCAGGGGCATAACATTGTTTGCCATAAGAAACTGTCCAAATCTGGTCTCTCTTTCAAGTGAAGCTATGTGCCACCTTATCGCTTTTGACTATTTAGGTATAAGCGACTGCCCTAATCTGACCATGTCAAACACTATGTCAGAGGTTGTCCGGGAGAACATCACATCTGCAAGCAGCCTTGTCCTCCCATCTCTCAAACGTGTCAACATTAGCAGATGTGGCGTAACTGGGAGGTGGCTATCTCAACTGCTTTCACATTCGCAGCGCCTTGAGGAGTTGCTATTAACTGGTTGTCCACAGATAAAGTTTCTATCTACCAGTCAACCTACAGAAACAGAAGAAACCAGCAGTTTGGCTTCAGCAGGGATGATCTCAGCCCAAGATGAACAAGAGTTGAGACTGCCATATGATCTCGTATGTTCTCTCAAGGTGCTATGGATTCGGCAAAGCCCGGATCTGAAGTTCTTTGGGGGTAATAGAGACTCTACAAGATTTACCTCTCTTACACAGCTAGTCCTTGCTGGTTGCCCCAAGCTGGTCTCATCGTTGTTGGGAGAAACAAAAGATGATGGTACCATGGAGGTTGAATTACTCCCACCATCACTTGAGGACATTAGTATCATTCATCTCCCAAAAAATTTGCAGTCATTCAATCCTCAAGGCCTTCTTCATCTAAAAAAGTTAAGTCTAGCTAATAGCCGATCTTTGAAGTCTGTACAGCTGCATTCTTGCACGGCTTTACAGGAGCTGCAAATCCGGAGTTGTCCCCAGCTGGCTGTACTGGAGGGCTTGCACTACCTCACCTCCGTTTGTAGCTTGAATATCCAGATGAACCCCAAGCTATCTTGTGCATGGGATCTCAACCTGCAGGAGCAAGAACAAGGTGGCAATCAAATTCCGCTGCTTCCTCCGTCACTTGATAAACTTGAGATCGGGGCCCTCACAGACAGTGTCCAATCCCGTCTTCTGTCCTGCCTTCCTGTCATGACCAAATTAGCAATACAGAGAAGTCCAGAATTGACGTCTCTACAGCTGGGATGCTGCATTGCACTGAAAGAGTTGAGAATTGGAGATTGCAGCTCGCTTGCATTGATCGAGGGCCTCCAGTTCTGTACAAACCTGACATCCTTGAGAGTACTCAACTCCCCTGGCCTAGTTTCCTGTTTGGAGCTTGTGTCGCATCAGCAAAGGCCCTCTGAGATCTGGTCTGGACTGAGAACTCTTGAGATTGATGACGCATCTGTTCTTTCCATGCCCTTCTGCAAACAGCTCACATCTCTAACACACCTACGGTTCATATGTCAGTGTGGTGAACAGAGAGGGAACTTGGTGAGCCTGACAGGGGAACAAGAGAGAGCGTTACAGCTTCTAACCTCCCTTCAAGAACTTGAATTCTCGTGGTACACGAATCTCTTGTCACTTCCTGCAAACCTTCATAGCTTGACCTCCCTCGGGAGGTTATCTATCATCGGTTGTCAGAGCATCACAAGGCTGCCAGACATGGGCCTCTCAACTTCTCTCAGATCTCTCGAGTTATTCAATTGTGGTGAGGAGCTAGCCATGCAATGCAGAATTGCTGCAACGGATAAGCTAAGGGTCAGGATTGTTAATCATGATATGAATTAA


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein homologue NBS-LRR disease resistance protein homologue [Hordeum vulgare].

VVDAAIGWLVQTILGSYFTEQIEACTREIGLAEDVEKLKFEMRNVEMVLAAAEGRRIENKPLASSLDFLKELLYDSEDVMDELDYYRLQQQIEKGKGTAPSGVNPEGSYVFSSAPSSAFELVCSATSQMTSWASSSRKRKHEEEGPVQSTMLTYEIKHDISQRINGIVKGLCTIGSSVQRVLQLEVSRPTATSLESQNISNNARLTTSVPVEVKMYGRESERDKIIELLIEGGSSDLNVLPVVGIGGVGKTTLARFVCKDQRIRDHFDLQMWVCVSTDFNEVRLTHEILEHVCENSQEYENISNFNVLQKNLLKNIRNKRFLLVLDDMWEDKDMSGWIKFLAPLKGNQASGCMILATTRMDSVAKMIQTMDKVRLSGLNEEEFWLLFKACAFGNENYEGDPGLQSIGKQIVKALKGCPLAAQSVGALLNTSVSDKHWRAVRDKWRSLQEDANDILPVLKLSYDYLPVHLQHCFSYCSLYPEDKHFDGTELVHAWVSQNFVQCEDPTVKLEETGQQYLDRLVDLCFFQKVGSRYVMHDLMHELAGKVSSNECATIHGLKHEAIRPSVRHLSVITTAFDKDKPDSFPNEKFDKILEKVGPSQKLRTLMFFGRSSINLLESLRTLCRKANCLRFLRIYVRDADMSSIHSLFNPHHLRYLEYIPVVITDRSSYRVYNNTVFPQALTRFYHLQVWNMGISGNFAVPTDMHNLVNLRHLISHEKVHHAIACVGNMTSLQGLSFKVQNIGSFEIRELQSLNELVLLEISQLENVKTKEEASGARLLDKEYLETLSLSWQDNSTSLQIETAKDVLEGLQPHQDLKTLKITGYGGATSPTWLSNTSPVTLVQILHLEKCREWKILPAPAMLPFLRKLTLIRMLNLTEISVPSLEELILIGMPELKKCTGSYGTELTSRLRVLMIKNCPELNELTLFRSYSSFNAEQKSWFPSLSKLSIGQCPHILNDWPILPLIEMKALNELELMDLHVVRVSVPSLEKLVLIKMPNLEFCSSVTTQGDQMGLPSSLRRLTIRDCPCLVVSHPLPPSALISEMSIRGVPGLAEMRINHRQFTIESNELCVLDGSILAFHNLRGITLFAIRNCPNLVSLSSEAMCHLIAFDYLGISDCPNLTMSNTMSEVVRENITSASSLVLPSLKRVNISRCGVTGRWLSQLLSHSQRLEELLLTGCPQIKFLSTSQPTETEETSSLASAGMISAQDEQELRLPYDLVCSLKVLWIRQSPDLKFFGGNRDSTRFTSLTQLVLAGCPKLVSSLLGETKDDGTMEVELLPPSLEDISIIHLPKNLQSFNPQGLLHLKKLSLANSRSLKSVQLHSCTALQELQIRSCPQLAVLEGLHYLTSVCSLNIQMNPKLSCAWDLNLQEQEQGGNQIPLLPPSLDKLEIGALTDSVQSRLLSCLPVMTKLAIQRSPELTSLQLGCCIALKELRIGDCSSLALIEGLQFCTNLTSLRVLNSPGLVSCLELVSHQQRPSEIWSGLRTLEIDDASVLSMPFCKQLTSLTHLRFICQCGEQRGNLVSLTGEQERALQLLTSLQELEFSWYTNLLSLPANLHSLTSLGRLSIIGCQSITRLPDMGLSTSLRSLELFNCGEELAMQCRIAATDKLRVRIVNHDMN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
65-1335 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SLDFLKELLYDSEDVMDELDYYRLQQQIEKGKGTAPSGVNPEGSYVFSSAPSSAFELVCSATSQMTSWASSSRKRKHEEEGPVQSTMLTYEIKHDISQRINGIVKGLCTIGSSVQRVLQLEVSRPTATSLESQNISNNARLTTSVPVEVKMYGRESERDKIIELLIEGGSSDLNVLPVVGIGGVGKTTLARFVCKDQRIRDHFDLQMWVCVSTDFNEVRLTHEILEHVCENSQEYENISNFNVLQKNLLKNIRNKRFLLVLDDMWEDKDMSGWIKFLAPLKGNQASGCMILATTRMDSVAKMIQTMDKVRLSGLNEEEFWLLFKACAFGNENYEGDPGLQSIGKQIVKALKGCPLAAQSVGALLNTSVSDKHWRAVRDKWRSLQEDANDILPVLKLSYDYLPVHLQHCFSYCSLYPEDKHFDGTELVHAWVSQNFVQCEDPTVKLEETGQQYLDRLVDLCFFQKVGSRYVMHDLMHELAGKVSSNECATIHGLKHEAIRPSVRHLSVITTAFDKDKPDSFPNEKFDKILEKVGPSQKLRTLMFFGRSSINLLESLRTLCRKANCLRFLRIYVRDADMSSIHSLFNPHHLRYLEYIPVVITDRSSYRVYNNTVFPQALTRFYHLQVWNMGISGNFAVPTDMHNLVNLRHLISHEKVHHAIACVGNMTSLQGLSFKVQNIGSFEIRELQSLNELVLLEISQLENVKTKEEASGARLLDKEYLETLSLSWQDNSTSLQIETAKDVLEGLQPHQDLKTLKITGYGGATSPTWLSNTSPVTLVQILHLEKCREWKILPAPAMLPFLRKLTLIRMLNLTEISVPSLEELILIGMPELKKCTGSYGTELTSRLRVLMIKNCPELNELTLFRSYSSFNAEQKSWFPSLSKLSIGQCPHILNDWPILPLIEMKALNELELMDLHVVRVSVPSLEKLVLIKMPNLEFCSSVTTQGDQMGLPSSLRRLTIRDCPCLVVSHPLPPSALISEMSIRGVPGLAEMRINHRQFTIESNELCVLDGSILAFHNLRGITLFAIRNCPNLVSLSSEAMCHLIAFDYLGISDCPNLTMSNTMSEVVRENITSASSLVLPSLKRVNISRCGVTGRWLSQLLSHSQRLEELLLTGCPQIKFLSTSQPTETEETSSLASAGMISAQDEQELRLPYDLVCSLKVLWIRQSPDLKFFGGNRDSTRFTSLTQLVLAGCPKLVSSLLGETKDDGTMEVELLPPSLEDISIIHLPKNLQSFNPQGLLHLKKLSLANSRSLKSVQLHSCTALQELQIRS

HMMPanther: PTHR11017:SF28
65-1335 PTHR11017:SF28

SLDFLKELLYDSEDVMDELDYYRLQQQIEKGKGTAPSGVNPEGSYVFSSAPSSAFELVCSATSQMTSWASSSRKRKHEEEGPVQSTMLTYEIKHDISQRINGIVKGLCTIGSSVQRVLQLEVSRPTATSLESQNISNNARLTTSVPVEVKMYGRESERDKIIELLIEGGSSDLNVLPVVGIGGVGKTTLARFVCKDQRIRDHFDLQMWVCVSTDFNEVRLTHEILEHVCENSQEYENISNFNVLQKNLLKNIRNKRFLLVLDDMWEDKDMSGWIKFLAPLKGNQASGCMILATTRMDSVAKMIQTMDKVRLSGLNEEEFWLLFKACAFGNENYEGDPGLQSIGKQIVKALKGCPLAAQSVGALLNTSVSDKHWRAVRDKWRSLQEDANDILPVLKLSYDYLPVHLQHCFSYCSLYPEDKHFDGTELVHAWVSQNFVQCEDPTVKLEETGQQYLDRLVDLCFFQKVGSRYVMHDLMHELAGKVSSNECATIHGLKHEAIRPSVRHLSVITTAFDKDKPDSFPNEKFDKILEKVGPSQKLRTLMFFGRSSINLLESLRTLCRKANCLRFLRIYVRDADMSSIHSLFNPHHLRYLEYIPVVITDRSSYRVYNNTVFPQALTRFYHLQVWNMGISGNFAVPTDMHNLVNLRHLISHEKVHHAIACVGNMTSLQGLSFKVQNIGSFEIRELQSLNELVLLEISQLENVKTKEEASGARLLDKEYLETLSLSWQDNSTSLQIETAKDVLEGLQPHQDLKTLKITGYGGATSPTWLSNTSPVTLVQILHLEKCREWKILPAPAMLPFLRKLTLIRMLNLTEISVPSLEELILIGMPELKKCTGSYGTELTSRLRVLMIKNCPELNELTLFRSYSSFNAEQKSWFPSLSKLSIGQCPHILNDWPILPLIEMKALNELELMDLHVVRVSVPSLEKLVLIKMPNLEFCSSVTTQGDQMGLPSSLRRLTIRDCPCLVVSHPLPPSALISEMSIRGVPGLAEMRINHRQFTIESNELCVLDGSILAFHNLRGITLFAIRNCPNLVSLSSEAMCHLIAFDYLGISDCPNLTMSNTMSEVVRENITSASSLVLPSLKRVNISRCGVTGRWLSQLLSHSQRLEELLLTGCPQIKFLSTSQPTETEETSSLASAGMISAQDEQELRLPYDLVCSLKVLWIRQSPDLKFFGGNRDSTRFTSLTQLVLAGCPKLVSSLLGETKDDGTMEVELLPPSLEDISIIHLPKNLQSFNPQGLLHLKKLSLANSRSLKSVQLHSCTALQELQIRS

superfamily: SSF52540
198-451 SSF52540

NISNNARLTTSVPVEVKMYGRESERDKIIELLIEGGSSDLNVLPVVGIGGVGKTTLARFVCKDQRIRDHFDLQMWVCVSTDFNEVRLTHEILEHVCENSQEYENISNFNVLQKNLLKNIRNKRFLLVLDDMWEDKDMSGWIKFLAPLKGNQASGCMILATTRMDSVAKMIQTMDKVRLSGLNEEEFWLLFKACAFGNENYEGDPGLQSIGKQIVKALKGCPLAAQSVGALLNTSVSDKHWRAVRDKWRSLQEDA

Gene3D: G3DSA:3.40.50.300
215-330 G3DSA:3.40.50.300

MYGRESERDKIIELLIEGGSSDLNVLPVVGIGGVGKTTLARFVCKDQRIRDHFDLQMWVCVSTDFNEVRLTHEILEHVCENSQEYENISNFNVLQKNLLKNIRNKRFLLVLDDMWE

HMMPfam: PF00931
IPR002182
219-504 NB-ARC,NBS
NB-ARC

ESERDKIIELLIEGGSSDLNVLPVVGIGGVGKTTLARFVCKDQRIRDHFDLQMWVCVSTDFNEVRLTHEILEHVCENSQEYENISNFNVLQKNLLKNIRNKRFLLVLDDMWEDKDMSGWIKFLAPLKGNQASGCMILATTRMDSVAKMIQTMDKVRLSGLNEEEFWLLFKACAFGNENYEGDPGLQSIGKQIVKALKGCPLAAQSVGALLNTSVSDKHWRAVRDKWRSLQEDANDILPVLKLSYDYLPVHLQHCFSYCSLYPEDKHFDGTELVHAWVSQNFVQCED

FPrintScan: PR00364
IPR000767
239-254 DISEASERSIST
Disease resistance protein

VLPVVGIGGVGKTTLA

FPrintScan: PR00364
IPR000767
315-329 DISEASERSIST
Disease resistance protein

NIRNKRFLLVLDDMW

FPrintScan: PR00364
IPR000767
414-428 DISEASERSIST
Disease resistance protein

LKGCPLAAQSVGALL

superfamily: SSF52058
534-1027 SSF52058,LRR

VMHDLMHELAGKVSSNECATIHGLKHEAIRPSVRHLSVITTAFDKDKPDSFPNEKFDKILEKVGPSQKLRTLMFFGRSSINLLESLRTLCRKANCLRFLRIYVRDADMSSIHSLFNPHHLRYLEYIPVVITDRSSYRVYNNTVFPQALTRFYHLQVWNMGISGNFAVPTDMHNLVNLRHLISHEKVHHAIACVGNMTSLQGLSFKVQNIGSFEIRELQSLNELVLLEISQLENVKTKEEASGARLLDKEYLETLSLSWQDNSTSLQIETAKDVLEGLQPHQDLKTLKITGYGGATSPTWLSNTSPVTLVQILHLEKCREWKILPAPAMLPFLRKLTLIRMLNLTEISVPSLEELILIGMPELKKCTGSYGTELTSRLRVLMIKNCPELNELTLFRSYSSFNAEQKSWFPSLSKLSIGQCPHILNDWPILPLIEMKALNELELMDLHVVRVSVPSLEKLVLIKMPNLEFCSSVTTQGDQMGLPSSLRRLTIRDCP

Gene3D: G3DSA:3.80.10.10
600-823 G3DSA:3.80.10.10

QKLRTLMFFGRSSINLLESLRTLCRKANCLRFLRIYVRDADMSSIHSLFNPHHLRYLEYIPVVITDRSSYRVYNNTVFPQALTRFYHLQVWNMGISGNFAVPTDMHNLVNLRHLISHEKVHHAIACVGNMTSLQGLSFKVQNIGSFEIRELQSLNELVLLEISQLENVKTKEEASGARLLDKEYLETLSLSWQDNSTSLQIETAKDVLEGLQPHQDLKTLKITG

FPrintScan: PR00364
IPR000767
751-767 DISEASERSIST
Disease resistance protein

QSLNELVLLEISQLENV

superfamily: SSF52058
979-1373 SSF52058,LRR

HVVRVSVPSLEKLVLIKMPNLEFCSSVTTQGDQMGLPSSLRRLTIRDCPCLVVSHPLPPSALISEMSIRGVPGLAEMRINHRQFTIESNELCVLDGSILAFHNLRGITLFAIRNCPNLVSLSSEAMCHLIAFDYLGISDCPNLTMSNTMSEVVRENITSASSLVLPSLKRVNISRCGVTGRWLSQLLSHSQRLEELLLTGCPQIKFLSTSQPTETEETSSLASAGMISAQDEQELRLPYDLVCSLKVLWIRQSPDLKFFGGNRDSTRFTSLTQLVLAGCPKLVSSLLGETKDDGTMEVELLPPSLEDISIIHLPKNLQSFNPQGLLHLKKLSLANSRSLKSVQLHSCTALQELQIRSCPQLAVLEGLHYLTSVCSLNIQMNPKLSCAWDLNLQEQ

superfamily: SSF52058
1301-1597 SSF52058,LRR

QGLLHLKKLSLANSRSLKSVQLHSCTALQELQIRSCPQLAVLEGLHYLTSVCSLNIQMNPKLSCAWDLNLQEQEQGGNQIPLLPPSLDKLEIGALTDSVQSRLLSCLPVMTKLAIQRSPELTSLQLGCCIALKELRIGDCSSLALIEGLQFCTNLTSLRVLNSPGLVSCLELVSHQQRPSEIWSGLRTLEIDDASVLSMPFCKQLTSLTHLRFICQCGEQRGNLVSLTGEQERALQLLTSLQELEFSWYTNLLSLPANLHSLTSLGRLSIIGCQSITRLPDMGLSTSLRSLELFNCG

Gene3D: G3DSA:3.80.10.10
1489-1596 G3DSA:3.80.10.10

LEIDDASVLSMPFCKQLTSLTHLRFICQCGEQRGNLVSLTGEQERALQLLTSLQELEFSWYTNLLSLPANLHSLTSLGRLSIIGCQSITRLPDMGLSTSLRSLELFNC


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox