PRGDB00047314 (rga S-114)

From PRG Wiki
Jump to: navigation, search
rga S-114
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 28555874 (AJ506147)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Hordeum vulgare

Comment?

Hordeum vulgare partial rga S-114 gene for NBS-LRR disease resistance protein homologue, exons 1-2.

DNA Sequence

GGGATGGGGGGAGTGGGGAAGACGACACTTGCCAAAGAGCTGTACCGGAGAATCAGCAGCCTATTTGACTGCAGGGCATTTGTCCGTACGTCCCGAAAGCCTGATGCCAGGAGGCTTCTCATCAGCATGCTCTCTCAGATTCGGCCACACCACACCCCTCACAATTGGAAGGTGCATAGCCTCATTGCTGATATCAGGACACATCTGCAAGATAAGAGGTACTTGATTGTAATTGATGATGTATGGGCTACACAAACATGGGATATCATAAATCGTGCCTTGCCGGCTGGTAATCTTTGCAGTGGTATACTAGTAACGACAGAAGTCGATGATGTAGCTCTGAAATGCTGTGACTATGACTCTAAGTATGTTCTTACAATGAAACCACTTGGTCAAGATGATTCAAGCAAATTATTTTTCAGCACAGTTTTTGGTCCACAGTATGATTGTCCTCCAGAACTCAGTGAAGTTGCAAACAACATTATAAGGAAATGTGCTGGTTTCCCCTTCGCCTTCATTACCCTCGGC


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein homologue NBS-LRR disease resistance protein homologue [Hordeum vulgare].

GMGGVGKTTLAKELYRRISSLFDCRAFVRTSRKPDARRLLISMLSQIRPHHTPHNWKVHSLIADIRTHLQDKRYLIVIDDVWATQTWDIINRALPAGNLCSGILVTTEVDDVALKCCDYDSKYVLTMKPLGQDDSSKLFFSTVFGPQYDCPPELSEVANNIIRKCAGFPFAFITLG

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
1-175 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GMGGVGKTTLAKELYRRISSLFDCRAFVRTSRKPDARRLLISMLSQIRPHHTPHNWKVHSLIADIRTHLQDKRYLIVIDDVWATQTWDIINRALPAGNLCSGILVTTEVDDVALKCCDYDSKYVLTMKPLGQDDSSKLFFSTVFGPQYDCPPELSEVANNIIRKCAGFPFAFITL

HMMPanther: PTHR11017:SF126
1-175 PTHR11017:SF126,OS11G0237600 PROTEIN

GMGGVGKTTLAKELYRRISSLFDCRAFVRTSRKPDARRLLISMLSQIRPHHTPHNWKVHSLIADIRTHLQDKRYLIVIDDVWATQTWDIINRALPAGNLCSGILVTTEVDDVALKCCDYDSKYVLTMKPLGQDDSSKLFFSTVFGPQYDCPPELSEVANNIIRKCAGFPFAFITL

superfamily: SSF52540
1-176 SSF52540

GMGGVGKTTLAKELYRRISSLFDCRAFVRTSRKPDARRLLISMLSQIRPHHTPHNWKVHSLIADIRTHLQDKRYLIVIDDVWATQTWDIINRALPAGNLCSGILVTTEVDDVALKCCDYDSKYVLTMKPLGQDDSSKLFFSTVFGPQYDCPPELSEVANNIIRKCAGFPFAFITLG

HMMPfam: PF00931
IPR002182
1-176 NB-ARC,NBS
NB-ARC

GMGGVGKTTLAKELYRRISSLFDCRAFVRTSRKPDARRLLISMLSQIRPHHTPHNWKVHSLIADIRTHLQDKRYLIVIDDVWATQTWDIINRALPAGNLCSGILVTTEVDDVALKCCDYDSKYVLTMKPLGQDDSSKLFFSTVFGPQYDCPPELSEVANNIIRKCAGFPFAFITLG

Gene3D: G3DSA:3.40.50.300
1-112 G3DSA:3.40.50.300

GMGGVGKTTLAKELYRRISSLFDCRAFVRTSRKPDARRLLISMLSQIRPHHTPHNWKVHSLIADIRTHLQDKRYLIVIDDVWATQTWDIINRALPAGNLCSGILVTTEVDDV

FPrintScan: PR00364
IPR000767
68-82 DISEASERSIST
Disease resistance protein

HLQDKRYLIVIDDVW

FPrintScan: PR00364
IPR000767
165-176 DISEASERSIST
Disease resistance protein

CAGFPFAFITLG


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox