PRGDB00047317 (rga S-T56)

From PRG Wiki
Jump to: navigation, search
rga S-T56
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 28555866 (AJ506144)
Gene Class N
Domain Type NBS
Gene Species Hordeum vulgare subsp. spontaneum

Comment?

Hordeum vulgare subsp. spontaneum partial rga S-T56 gene for NBS-LRR disease resistance protein homologue.

DNA Sequence

GTGCAGAATCATTTTCCAGTCAGGATTTGGATATGCGTGTCGTTCAATTTCAACCTGGATAAGGTGCTTGAACAGATTAAAAGAGATACCCTTCCTGTTGTTGTAGGTGAAAATGGGTGTAGTACAACACAAGAGTTCATTGAACACAGGTTGATATGCAAAAGATTCTTACTTATATTGGATGACATATGGCAATTTATTAATGCGGATGACTGGAACAAATTATTGGTTATACTTGGCCAGACAGAAGAAAAAGGTTGCATGATTCTAGTCACAACTCGATTTCAGGCAATAGCACAGATGGTTAAAACAACTGACCATCCAAAAGAACTAAACGGTTTAGAACCTGAAGAGTTTAGGAAATTATTCCTTGTATTTGTCTTTGATGATGGGCAATGTCCAGGGAATAAACTTCATTTCCTAGATAAGATAATGGAAAAACTTAAGGGCTCCC


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein homologue NBS-LRR disease resistance protein homologue [Hordeum vulgare subsp. spontaneum].

VQNHFPVRIWICVSFNFNLDKVLEQIKRDTLPVVVGENGCSTTQEFIEHRLICKRFLLILDDIWQFINADDWNKLLVILGQTEEKGCMILVTTRFQAIAQMVKTTDHPKELNGLEPEEFRKLFLVFVFDDGQCPGNKLHFLDKIMEKLKGS


Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
1-150 NB-ARC,NBS
NB-ARC

VQNHFPVRIWICVSFNFNLDKVLEQIKRDTLPVVVGENGCSTTQEFIEHRLICKRFLLILDDIWQFINADDWNKLLVILGQTEEKGCMILVTTRFQAIAQMVKTTDHPKELNGLEPEEFRKLFLVFVFDDGQCPGNKLHFLDKIMEKLKG

superfamily: SSF52540
5-133 SSF52540

FPVRIWICVSFNFNLDKVLEQIKRDTLPVVVGENGCSTTQEFIEHRLICKRFLLILDDIWQFINADDWNKLLVILGQTEEKGCMILVTTRFQAIAQMVKTTDHPKELNGLEPEEFRKLFLVFVFDDGQC


List of References

L H Madsen, N C Collins, M Rakwalska, G Backes, N Sandal, L Krusell, J Jensen, E H Waterman, A Jahoor, M Ayliffe, A J Pryor, P Langridge, P Schulze-Lefert, J Stougaard
Barley disease resistance gene analogs of the NBS-LRR class: identification and mapping.
Mol. Genet. Genomics: 2003, 269(1);150-61
PubMed:12715163 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox