PRGDB00047345 (AT4g11430)

From PRG Wiki
Jump to: navigation, search
AT4g11430
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 7267806 (AL161531)
Gene Class TNL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana DNA chromosome 4, contig fragment No. 31.

DNA Sequence

ATGGCATCTTCTTCTTCAAACTCTTGGAGATACGACGTCTTTCCTAGTTTCAGAGGGGAAGATGTCCGTAATAACTTTCTCAGCCACTTGCTCAAAGAATTTGAAAGCAAAGGAATAGTGACATTCAGAGATGACCATATCAAAAGAAGCCACACGATCGGTCATGAGCTTAGAGCAGCCATTAGAGAATCTAAGATCTCAGTAGTCTTGTTCTCAGAGAACTATGCTTCTTCAAGCTGGTGTTTGGACGAGCTGATTGAGATCATGAAGTGTAAGGAAGAACAAGGACTGAAAGTGATGCCGGTTTTCTACAAAGTGGATCCATCTGATATAAGAAAACAGACCGGAAAGTTTGGAATGAGTTTCTTGGAAACTTGTTGTGGTAAGACGGAGGAGCGACAACATAACTGGAGGCGGGCGTTGACTGATGCTGCCAATATTCTTGGAGATCATCCTCAAAATTGGGACAATGAAGCATATAAGATCACAACAATTTCCAAGGATGTATTAGAAAAATTAAATGCAACGCCATCAAGAGATTTCAATGACTTGGTTGGAATGGAAGCTCACATTGCAAAGATGGAATCATTGTTATGCCTTGAGTCTCAAGGAGTGAGGATAGTAGGGATATGGGGTCCTGCAGGCGTTGGTAAGACTACCATAGCTAGAGCTTTATATAACCAATATCATGAAAACTTCAATCTTTCTATATTTATGGAGAATGTTAGAGAAAGTTATGGTGAAGCAGGCCTCGATGACTATGGTTTGAAGCTGCATTTACAACAAAGATTTTTATCCAAACTTCTTGATCAAAAGGATTTGAGAGTACGTCATTTAGGCGCAATAGAAGAAAGGCTAAAGAGCCAAAAAGTTCTAATTATTCTTGATGATGTGGACAATATTGAGCAACTCAAAGCCTTGGCAAAGGAAAATCAATGGTTTGGTAACAAGAGCAGAATTGTCGTGACAACCCAAAACAAACAACTTTTGGTTTCTCATGATATCAACCATATGTACCAGGTGGCTTATCCTTCAAAACAAGAAGCTCTTACTATATTTTGCCAGCATGCTTTTAAGCAAAGTTCCCCATCAGATGATTTAAAGCACCTTGCAATTGAATTTACAACTCTTGCTGGTCATCTTCCGCTGGCTCTACGGGTTCTTGGTTCGTTTATGCGTGGAAAGGGTAAGGAAGAGTGGGAATTTTCCCTGCCTACGCTAAAAAGTCGACTTGATGGAGAGGTAGAGAAAGTATTAAAAGTCGGGTATGATGGCTTGCATGACCATGAAAAAGATTTATTTCTTCATATTGCATGTATTTTTAGCGGTCAACACGAAAACTATTTGAAACAGATGATCATAGCTAACAATGACACATATGTTAGTTTCGGACTTCAAGTCCTGGCTGATAAATCTCTCATACAAAAATTTGAGAATGGTAGAATCGAGATGCACTCCTTACTACGACAATTAGGCAAAGAAGTTGTTCGAAAGCAATCTATTTACGAGCCAGGAAAACGTCAATTCTTGATGAATGCTAAGGAAACGTGTGGCGTCCTTTCAAACAATACTGGTACGGGAACTGTATTAGGTATATCGTTAGATATGTGTGAGATCAAAGAGGAGTTATATATAAGTGAGAAAACTTTTGAAGAGATGCGGAACCTCGTATATCTAAAATTCTATATGAGTAGTCCTATAGATGATAAAATGAAAGTCAAGTTGCAGTTACCAGAAGAAGGGCTAAGCTATCTACCGCAATTGAGGTTATTACACTGGGATGCATATCCTCTTGAGTTTTTCCCTTCTAGCTTTCGACCCGAATGTCTTGTCGAACTCAACATGTCTCATAGCAAGCTTAAGAAGCTATGGAGTGGAGTTCAGCCGCTTAGAAATCTCAGGACAATGAATCTAAATAGCTCTCGGAATCTGGAAATCCTTCCAAATCTTATGGAAGCAACAAAGCTTAACAGATTGGATTTGGGTTGGTGTGAGTCTTTGGTGGAGCTTCCTTCATCTATAAAGAACCTTCAGCATCTGATTTTGTTAGAGATGTCTTGTTGCAAAAAATTAGAGATCATCCCAACTAACATCAACTTACCATCTCTAGAGGTCCTCCACTTTAGGTATTGCACACGATTGCAAACCTTTCCAGAGATTTCAACCAATATTCGTCTTCTCAATTTAATAGGCACTGCGATCACTGAGGTGCCTCCATCAGTAAAATATTGGAGTAAAATTGATGAAATTTGTATGGAGAGGGCTAAGGTCAAGAGATTGGTTCATGTTCCTTATGTTTTAGAAAAGCTATGTTTGAGGGAAAATAAAGAATTGGAGACTATTCCGCGATACCTCAAATATCTCCCTCGGCTGCAGATGATTGACATCTCCTATTGCATCAATATTATATCGCTACCGAAGCTTCCAGGCTCAGTATCCGCCTTAACAGCTGTAAACTGCGAGTCACTTCAAATACTACATGGCCACTTTCGAAACAAAAGTATCCACCTGAATTTCATTAACTGTTTAAAGCTAGGTCAGAGAGCCCAAGAAAAGATCCACCGGTCAGTTTACATCCACCAGTCCTCATACATAGCTGATGTCTTACCTGGTGAACATGTACCTGCGTACTTCAGCTACCGAAGTACCGGAAGTTCCATAATGATCCATTCAAATAAGGTTGATCTTTCAAAGTTTAACAGGTTTAAGGTATGCCTTGTGCTTGGAGCGGGAAAACGTTTCGAAGGTTGTGACATAAAATTTTACAAACAATTTTTCTGTAAACCGAGAGAGTATTACGTGCCAAAGCATTTGGATTCACCACTACTTAAAAGTGATCATCTTTGCATGTGCGAGTTTGAATTAATGCCACCACATCCTCCAACGGAATGGGAGCTTCTCCACCCAAACGAATTCCTGGAGGTTTCCTTTGAGAGTCGCGGCGGCCTTTATAAGTGCGAAGTAAAAGAATGCGGTTTACAGTTCCTGGAGCCTCATGAGACATCTGAGTTTCGGTATCTGTCACCTCATCTGTACTTGGGTGGTAGTTGGATTGGAAATAGTAGTAGTAGTATTGAAGAAATTATCCATGTAGACCAAGAGGAAAGCAGTAGTGATAGTGAAGAAATTATCTATGCGGACCAAGAGGAAAGCAGTAGTGAATTCCCAAATTCGGATTGCCAAATAAACTATGTTGCAAGCAATTCAGTTGTGAATATCCGGCCAATGATACGATGCCAGAGAGCAAGCGGAGGAAGAGGAGGAGCTAATAGAAGCAAACCTGCTAAGCCGCAAGTTAAAGAAGGAAGCAACAAAACAGTAATCGAAGGTTTAGTAACCGAATCGCTACCTAATGGAATGTTTCGAGTCGATTTGGAGAATGGTGACAACATTCTTGGTTATATTTGTGGTAAGATTAGGAAGAATTTCATTCGGATACTCCCCGGTGATAAAGTGAAAGTCGAAATGAGTGTTTATGATTCTACTAAAGGTCGTATCATTTTCAGAATGAGTAGTAGAGACTAA


Protein sequences

Name Description Sequence
RPP1-WsA-like disease resistance protein RPP1-WsA-like disease resistance protein [Arabidopsis thaliana].

MASSSSNSWRYDVFPSFRGEDVRNNFLSHLLKEFESKGIVTFRDDHIKRSHTIGHELRAAIRESKISVVLFSENYASSSWCLDELIEIMKCKEEQGLKVMPVFYKVDPSDIRKQTGKFGMSFLETCCGKTEERQHNWRRALTDAANILGDHPQNWDNEAYKITTISKDVLEKLNATPSRDFNDLVGMEAHIAKMESLLCLESQGVRIVGIWGPAGVGKTTIARALYNQYHENFNLSIFMENVRESYGEAGLDDYGLKLHLQQRFLSKLLDQKDLRVRHLGAIEERLKSQKVLIILDDVDNIEQLKALAKENQWFGNKSRIVVTTQNKQLLVSHDINHMYQVAYPSKQEALTIFCQHAFKQSSPSDDLKHLAIEFTTLAGHLPLALRVLGSFMRGKGKEEWEFSLPTLKSRLDGEVEKVLKVGYDGLHDHEKDLFLHIACIFSGQHENYLKQMIIANNDTYVSFGLQVLADKSLIQKFENGRIEMHSLLRQLGKEVVRKQSIYEPGKRQFLMNAKETCGVLSNNTGTGTVLGISLDMCEIKEELYISEKTFEEMRNLVYLKFYMSSPIDDKMKVKLQLPEEGLSYLPQLRLLHWDAYPLEFFPSSFRPECLVELNMSHSKLKKLWSGVQPLRNLRTMNLNSSRNLEILPNLMEATKLNRLDLGWCESLVELPSSIKNLQHLILLEMSCCKKLEIIPTNINLPSLEVLHFRYCTRLQTFPEISTNIRLLNLIGTAITEVPPSVKYWSKIDEICMERAKVKRLVHVPYVLEKLCLRENKELETIPRYLKYLPRLQMIDISYCINIISLPKLPGSVSALTAVNCESLQILHGHFRNKSIHLNFINCLKLGQRAQEKIHRSVYIHQSSYIADVLPGEHVPAYFSYRSTGSSIMIHSNKVDLSKFNRFKVCLVLGAGKRFEGCDIKFYKQFFCKPREYYVPKHLDSPLLKSDHLCMCEFELMPPHPPTEWELLHPNEFLEVSFESRGGLYKCEVKECGLQFLEPHETSEFRYLSPHLYLGGSWIGNSSSSIEEIIHVDQEESSSDSEEIIYADQEESSSEFPNSDCQINYVASNSVVNIRPMIRCQRASGGRGGANRSKPAKPQVKEGSNKTVIEGLVTESLPNGMFRVDLENGDNILGYICGKIRKNFIRILPGDKVKVEMSVYDSTKGRIIFRMSSRD

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-149 Toll/Interleukin receptor TIR domain
Toll/interleukin-1 receptor homology (TIR) domain

MASSSSNSWRYDVFPSFRGEDVRNNFLSHLLKEFESKGIVTFRDDHIKRSHTIGHELRAAIRESKISVVLFSENYASSSWCLDELIEIMKCKEEQGLKVMPVFYKVDPSDIRKQTGKFGMSFLETCCGKTEERQHNWRRALTDAANILG

Gene3D: G3DSA:3.40.50.10140
7-141 no description

NSWRYDVFPSFRGEDVRNNFLSHLLKEFESKGIVTFRDDHIKRSHTIGHELRAAIRESKISVVLFSENYASSSWCLDELIEIMKCKEEQGLKVMPVFYKVDPSDIRKQTGKFGMSFLETCCGKTEERQHNWRRAL

ProfileScan: PS50104
IPR000157
9-147 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WRYDVFPSFRGEDVRNNFLSHLLKEFESKGIVTFRDDHIKRSHTIGHELRAAIRESKISVVLFSENYASSSWCLDELIEIMKCKEEQGLKVMPVFYKVDPSDIRKQTGKFGMSFLETCCGKTEERQHNWRRALTDAANI

HMMSmart: SM00255
IPR000157
10-147 Toll
Toll/interleukin-1 receptor homology (TIR) domain

RYDVFPSFRGEDVRNNFLSHLLKEFESKGIVTFRDDHIKRSHTIGHELRAAIRESKISVVLFSENYASSSWCLDELIEIMKCKEEQGLKVMPVFYKVDPSDIRKQTGKFGMSFLETCCGKTEERQHNWRRALTDAANI

HMMPfam: PF01582
IPR000157
13-142 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFRGEDVRNNFLSHLLKEFESKGIVTFRDDHIKRSHTIGHELRAAIRESKISVVLFSENYASSSWCLDELIEIMKCKEEQGLKVMPVFYKVDPSDIRKQTGKFGMSFLETCCGKTEERQHNWRRALT

HMMPanther: PTHR11017
33-1054 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

EFESKGIVTFRDDHIKRSHTIGHELRAAIRESKISVVLFSENYASSSWCLDELIEIMKCKEEQGLKVMPVFYKVDPSDIRKQTGKFGMSFLETCCGKTEERQHNWRRALTDAANILGDHPQNWDNEAYKITTISKDVLEKLNATPSRDFNDLVGMEAHIAKMESLLCLESQGVRIVGIWGPAGVGKTTIARALYNQYHENFNLSIFMENVRESYGEAGLDDYGLKLHLQQRFLSKLLDQKDLRVRHLGAIEERLKSQKVLIILDDVDNIEQLKALAKENQWFGNKSRIVVTTQNKQLLVSHDINHMYQVAYPSKQEALTIFCQHAFKQSSPSDDLKHLAIEFTTLAGHLPLALRVLGSFMRGKGKEEWEFSLPTLKSRLDGEVEKVLKVGYDGLHDHEKDLFLHIACIFSGQHENYLKQMIIANNDTYVSFGLQVLADKSLIQKFENGRIEMHSLLRQLGKEVVRKQSIYEPGKRQFLMNAKETCGVLSNNTGTGTVLGISLDMCEIKEELYISEKTFEEMRNLVYLKFYMSSPIDDKMKVKLQLPEEGLSYLPQLRLLHWDAYPLEFFPSSFRPECLVELNMSHSKLKKLWSGVQPLRNLRTMNLNSSRNLEILPNLMEATKLNRLDLGWCESLVELPSSIKNLQHLILLEMSCCKKLEIIPTNINLPSLEVLHFRYCTRLQTFPEISTNIRLLNLIGTAITEVPPSVKYWSKIDEICMERAKVKRLVHVPYVLEKLCLRENKELETIPRYLKYLPRLQMIDISYCINIISLPKLPGSVSALTAVNCESLQILHGHFRNKSIHLNFINCLKLGQRAQEKIHRSVYIHQSSYIADVLPGEHVPAYFSYRSTGSSIMIHSNKVDLSKFNRFKVCLVLGAGKRFEGCDIKFYKQFFCKPREYYVPKHLDSPLLKSDHLCMCEFELMPPHPPTEWELLHPNEFLEVSFESRGGLYKCEVKECGLQFLEPHETSEFRYLSPHLYLGGSWIGNSSSSIEEIIHVDQEESSSDSEEIIYADQEESSSE

HMMPanther: PTHR11017:SF20
33-1054 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

EFESKGIVTFRDDHIKRSHTIGHELRAAIRESKISVVLFSENYASSSWCLDELIEIMKCKEEQGLKVMPVFYKVDPSDIRKQTGKFGMSFLETCCGKTEERQHNWRRALTDAANILGDHPQNWDNEAYKITTISKDVLEKLNATPSRDFNDLVGMEAHIAKMESLLCLESQGVRIVGIWGPAGVGKTTIARALYNQYHENFNLSIFMENVRESYGEAGLDDYGLKLHLQQRFLSKLLDQKDLRVRHLGAIEERLKSQKVLIILDDVDNIEQLKALAKENQWFGNKSRIVVTTQNKQLLVSHDINHMYQVAYPSKQEALTIFCQHAFKQSSPSDDLKHLAIEFTTLAGHLPLALRVLGSFMRGKGKEEWEFSLPTLKSRLDGEVEKVLKVGYDGLHDHEKDLFLHIACIFSGQHENYLKQMIIANNDTYVSFGLQVLADKSLIQKFENGRIEMHSLLRQLGKEVVRKQSIYEPGKRQFLMNAKETCGVLSNNTGTGTVLGISLDMCEIKEELYISEKTFEEMRNLVYLKFYMSSPIDDKMKVKLQLPEEGLSYLPQLRLLHWDAYPLEFFPSSFRPECLVELNMSHSKLKKLWSGVQPLRNLRTMNLNSSRNLEILPNLMEATKLNRLDLGWCESLVELPSSIKNLQHLILLEMSCCKKLEIIPTNINLPSLEVLHFRYCTRLQTFPEISTNIRLLNLIGTAITEVPPSVKYWSKIDEICMERAKVKRLVHVPYVLEKLCLRENKELETIPRYLKYLPRLQMIDISYCINIISLPKLPGSVSALTAVNCESLQILHGHFRNKSIHLNFINCLKLGQRAQEKIHRSVYIHQSSYIADVLPGEHVPAYFSYRSTGSSIMIHSNKVDLSKFNRFKVCLVLGAGKRFEGCDIKFYKQFFCKPREYYVPKHLDSPLLKSDHLCMCEFELMPPHPPTEWELLHPNEFLEVSFESRGGLYKCEVKECGLQFLEPHETSEFRYLSPHLYLGGSWIGNSSSSIEEIIHVDQEESSSDSEEIIYADQEESSSE

superfamily: SSF52540
64-435 P-loop containing nucleoside triphosphate hydrolases

SKISVVLFSENYASSSWCLDELIEIMKCKEEQGLKVMPVFYKVDPSDIRKQTGKFGMSFLETCCGKTEERQHNWRRALTDAANILGDHPQNWDNEAYKITTISKDVLEKLNATPSRDFNDLVGMEAHIAKMESLLCLESQGVRIVGIWGPAGVGKTTIARALYNQYHENFNLSIFMENVRESYGEAGLDDYGLKLHLQQRFLSKLLDQKDLRVRHLGAIEERLKSQKVLIILDDVDNIEQLKALAKENQWFGNKSRIVVTTQNKQLLVSHDINHMYQVAYPSKQEALTIFCQHAFKQSSPSDDLKHLAIEFTTLAGHLPLALRVLGSFMRGKGKEEWEFSLPTLKSRLDGEVEKVLKVGYDGLHDHEKDLFL

Gene3D: G3DSA:3.40.50.300
176-333 no description

TPSRDFNDLVGMEAHIAKMESLLCLESQGVRIVGIWGPAGVGKTTIARALYNQYHENFNLSIFMENVRESYGEAGLDDYGLKLHLQQRFLSKLLDQKDLRVRHLGAIEERLKSQKVLIILDDVDNIEQLKALAKENQWFGNKSRIVVTTQNKQLLVSH

HMMPfam: PF00931
IPR002182
188-452 NB-ARC,NBS
NB-ARC

EAHIAKMESLLCLESQGVRIVGIWGPAGVGKTTIARALYNQYHENFNLSIFMENVRESYGEAGLDDYGLKLHLQQRFLSKLLDQKDLRVRHLGAIEERLKSQKVLIILDDVDNIEQLKALAKENQWFGNKSRIVVTTQNKQLLVSHDINHMYQVAYPSKQEALTIFCQHAFKQSSPSDDLKHLAIEFTTLAGHLPLALRVLGSFMRGKGKEEWEFSLPTLKSRLDGEVEKVLKVGYDGLHDHEKDLFLHIACIFSGQHENYLKQM

HMMSmart: SM00382
IPR003593
204-388 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

GVRIVGIWGPAGVGKTTIARALYNQYHENFNLSIFMENVRESYGEAGLDDYGLKLHLQQRFLSKLLDQKDLRVRHLGAIEERLKSQKVLIILDDVDNIEQLKALAKENQWFGNKSRIVVTTQNKQLLVSHDINHMYQVAYPSKQEALTIFCQHAFKQSSPSDDLKHLAIEFTTLAGHLPLALRVL

FPrintScan: PR00364
IPR000767
207-222 DISEASERSIST
Disease resistance protein

IVGIWGPAGVGKTTIA

FPrintScan: PR00364
IPR000767
285-299 DISEASERSIST
Disease resistance protein

RLKSQKVLIILDDVD

FPrintScan: PR00364
IPR000767
378-392 DISEASERSIST
Disease resistance protein

AGHLPLALRVLGSFM

Gene3D: G3DSA:3.80.10.10
546-826 no description

SEKTFEEMRNLVYLKFYMSSPIDDKMKVKLQLPEEGLSYLPQLRLLHWDAYPLEFFPSSFRPECLVELNMSHSKLKKLWSGVQPLRNLRTMNLNSSRNLEILPNLMEATKLNRLDLGWCESLVELPSSIKNLQHLILLEMSCCKKLEIIPTNINLPSLEVLHFRYCTRLQTFPEISTNIRLLNLIGTAITEVPPSVKYWSKIDEICMERAKVKRLVHVPYVLEKLCLRENKELETIPRYLKYLPRLQMIDISYCINIISLPKLPGSVSALTAVNCESLQIL

superfamily: SSF52058
561-828 L domain-like,LRR

FYMSSPIDDKMKVKLQLPEEGLSYLPQLRLLHWDAYPLEFFPSSFRPECLVELNMSHSKLKKLWSGVQPLRNLRTMNLNSSRNLEILPNLMEATKLNRLDLGWCESLVELPSSIKNLQHLILLEMSCCKKLEIIPTNINLPSLEVLHFRYCTRLQTFPEISTNIRLLNLIGTAITEVPPSVKYWSKIDEICMERAKVKRLVHVPYVLEKLCLRENKELETIPRYLKYLPRLQMIDISYCINIISLPKLPGSVSALTAVNCESLQILHG

HMMPfam: PF07725
IPR011713
609-628 LRR_3
Leucine-rich repeat 3

CLVELNMSHSKLKKLWSGVQ

FPrintScan: PR00364
IPR000767
628-644 DISEASERSIST
Disease resistance protein

QPLRNLRTMNLNSSRNL

Seg: seg
1014-1029 seg

GGSWIGNSSSSIEEII

Seg: seg
1034-1042 seg

EESSSDSEE

Seg: seg
1081-1092 seg

RASGGRGGANRS

HAMAP: MF_00075
IPR004368
1098-1173 IF_1
Translation initiation factor IF-1

QVKEGSNKTVIEGLVTESLPNGMFRVDLENGDNILGYICGKIRKNFIRILPGDKVKVEMSVYDSTKGRIIFRMSSR

superfamily: SSF50249
IPR016027
1100-1170 Nucleic acid-binding proteins
Nucleic acid-binding, OB-fold-like

KEGSNKTVIEGLVTESLPNGMFRVDLENGDNILGYICGKIRKNFIRILPGDKVKVEMSVYDSTKGRIIFRM

HMMSmart: SM00316
IPR022967
1103-1171 Ribosomal protein S1-like RNA-binding domain
RNA-binding domain, S1

SNKTVIEGLVTESLPNGMFRVDLENGDNILGYICGKIRKNFIRILPGDKVKVEMSVYDSTKGRIIFRMS

Gene3D: G3DSA:2.40.50.140
IPR012340
1104-1170 no description
Nucleic acid-binding, OB-fold

NKTVIEGLVTESLPNGMFRVDLENGDNILGYICGKIRKNFIRILPGDKVKVEMSVYDSTKGRIIFRM

HMMTigr: TIGR00008
IPR004368
1105-1170 infA: translation initiation factor IF-1
Translation initiation factor IF-1

KTVIEGLVTESLPNGMFRVDLENGDNILGYICGKIRKNFIRILPGDKVKVEMSVYDSTKGRIIFRM

ProfileScan: PS50832
IPR006196
1108-1171 S1_IF1_TYPE
RNA-binding domain, S1, IF1 type

IEGLVTESLPNGMFRVDLENGDNILGYICGKIRKNFIRILPGDKVKVEMSVYDSTKGRIIFRMS

HMMPfam: PF01176
IPR006196
1108-1169 eIF-1a
RNA-binding domain, S1, IF1 type

IEGLVTESLPNGMFRVDLENGDNILGYICGKIRKNFIRILPGDKVKVEMSVYDSTKGRIIFR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox