PRGDB00047346 (F26O13.260)

From PRG Wiki
Jump to: navigation, search
F26O13.260
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 6572057 (AL133452)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana DNA chromosome 3, BAC clone F26O13.

DNA Sequence

ATGGAGGAGGCCTCTTCCTCTTCCGAGGTAAAAGCACTTCCTTTGCCGCCGCAGCATCAAGTGTTTGTAAATTTCAGAGGAGAAGAGTTGCGGAACAGCTTTGTTAGCCATCTCAGAAGTGCATTGGTTAGGCATGGGGTCAACATCTTCATAGACACGAATGAGGAAAAAGGTAAACCTTTACATGTGTTTTTCCAGAGGATTGAAGAGTCGAGGATCGCTTTGGCCATTTTTTCCGTTAGGTACACCGAATCGAAATGGTGCTTGAACGAGCTAGTGAAGATGAAGGAATGCATGGACAAGGGAAAGCTCCTCATCATTCCCATTTTCTACAAGGTTAAAGCATACGAAGTTCGGTATCAGAAGGGACGGTTTGGTTGTGTTTTCAAGAATTTGCGCAATGTTGATGTTCACAAGAAAAACCAGTGGTCTGAAGCTTTGAGCTCTGTTGCAGACCGGATCGGCTTCTCCTTTGATGGAAAGAGCGACGAGCACAACTTCATCAATGGTATTGTTGAAGAGGTTAAAGAAGCGCTGAGCAAGATTTTGTTGGACAAAACCAAAGATGCTTTCGTCTATCATTCGAAAAACAATTCAATGTCCGTAGGAAGAGAAAAGCACGAGATTTATGGACTCAAACAACGGTTAGAAGAATTAAAGGAGAAGCTAGATCTTGATTGTGAGGAGACTCGGATTTTGGGAGTTGTTGGGATGCCCGGTATTGGTAAAACCACTCTTGCAAGGGAGATTTATGAAACTTTGCGGTGCAAGTTCTTAAGGCATGGATTAATCCAAGATATTCGTAGAACATCGAAGGAGCACGGGTTGGATTGCTTGCCTGCATTACTCTTGGAAGAGTTACTCGGTGTGACAATTCCAGACATAGAATCTACTCGATGTGCATATGAATCTTACAAGATGGAACTACATACACATAAAGTTCTTGTTGTTCTCGACGATGTGAGTGACAAGGAACAGATAGATGTTCTTCTGGGGAGATGCAACTGGATTAGGCAGGGAAGCAGGATTGTCATTGCAACAAGCGACAAATCACTAATACAAGATGTGGCTGACTATACTTATGTTGTCCCACAGTTGAACCACAAAGACGGCTTAGGTCACTTTGGGCGTTATGCCTTTGATCGTCATTCCAACATACACAACAATGAAGTCATCATGAAGCTATCGAAAGAGTTTGTGCATTATGGTAGAGGTCATCCACTCGTTCTAAAGTTGTTGGGGGCAGATCTTAATGGGAAAGACGAGGACCATTGGAAAACAAAATTGGCTACACTAGCAGAAAATTCCAGCCATAGTATTCGAGATGTGTTACAAGTAAGTTATGATGAACTGAGTCAAGTGCATAAAGATATATTTCTCGACATAGCTTGTTTTAGATCGGAAGATGAGAGTTACATTGCTAGTCTACTGGATTCATCTGAAGCTGCAAGTGAAATAAAAGCTCTCATGAATAAATTCATGATTAATGTTTCCGAGGACCGAGTAGAGATGCATGATTTGCTATATACTTTCGCTAGGGAACTTTGCCGAAGAGCATATGCTCAAGATGGAAGGGAGCCACATAGGTTGTGGCACCACCAAGACATAACTGATGTGCTAAAGAACATAGAGGAAGGCGCAGAAGTCAGAGGGATTTTCCTAAACATGAATGAAATGAAGAGGGAGATGAGCTTAGACAGTTGCACTTTCAAATCGATGTGTGGTCTCCGATACCTCAAGATCTATAGCTCACATTGTCCTCAGCAATGTAAGCCTAACAATAAGATAAACCTCCCTGATGGGCTAAACTTCCCACTGAAAGAGGTTCGCTATCTCCACTGGCTAGAGTTCCCATTGAAGGAAATTCCACCAGATTTCAACCCGCAAAATCTTGTCGACCTTAAGCTTCCCCACAGCAAGATTGAACGAATCTGGAGTGATGATAAGCATAAGGATACACCAAAATTAAAGTGGGTCAATCTCAGTCATTCAAGTAACTTGTGGGACATTTCGGGGTTATCAAAGGCTCAACGTCTTGTTTTCCTAAATCTAAAAGGGTGTACAAGTCTCAAGTCTCTTCCGGAGATAAATTTAGTCTCTTTAGAAATTCTCATCCTCAGCAACTGCTCAAACCTTAAGGAATTCCGGGTGATCTCACAAAATCTAGAAACTCTATACTTGGATGGCACTTCAATTAAAGAACTTCCTTTGAACTTCAATATACTCCAGAGACTTGTTATATTGAATATGAAAGGATGCGCGAAGCTGAAGGAGTTTCCGGATTGTCTCGATGACTTGAAAGCTCTTAAAGAACTGATACTCTCAGATTGTTGGAAGCTCCAAAATTTTCCGGCAATCTGTGAAAGAATCAAGGTTTTAGAGATATTAAGATTGGATACTACAACCATAACAGAGATTCCGATGATATCGTCGTTACAATGTTTATGCTTAAGCAAGAATGATCACATCAGCTCCCTTCCAGATAACATCAGCCAACTTTCTCAACTAAAATGGTTGGACTTGAAGTATTGTAAGAGTCTTACATCTATTCCAAAGCTTCCACCAAATCTTCAACACTTAGATGCACACGGCTGTTGCTCACTTAAGACAGTCTCGAATCCACTGGCATGTCTTACTACGGCTCAACAGATTTATTCTACATTCATCCTCACGAACTGCAACAAACTCGAAAGGAGTGCTAAAGAAGAAATATCTTCCTTTGCTCAAAGGAAATGTCAGCTACTTTTAGATGCACAAAAGCGCTGCAATGTCAGTTCCTTGATCTCCTTCAGTATATGTTGCTATATATCAAAAATATTCGTGTCTATATGCATTTTCTTGTCTATATCTATGCAGAATTCTGATTCGGAGCCTTTGTTCAGTATATGCTTTCCTGGAAGTGAACTACCTTCATGGTTCTGTCATGAAGCTGTTGGACCTGTATTAGAGCTCAGAATGCCTCCACATTGGCATGAAAATAGGCTTGCCGGTGTAGCTCTATGTGCTGTTGTCACATTTCCAAAATCTCAAGAACAAATCAACTGTTTTTCAGTGAAATGCACATTCAAACTAGAAGTAAAAGAAGGGTCGTGGATCGAATTTTCATTCCCAGTTGGAAGATGGAGTAATCAGGGCAATATAGTTGCGAATATTGCATCAGAGCATGTCTTTATTGGGTATATCAGCTGTTCAAAGATCTTTAAACGTCTTGAAAACCAGTATTTTAGCAGCTCTAATCCTACAAGATCCACGCAATCTAGTAAATGTAGTCCTACTAAGGCCTCTCTTAATTTTATGGTCATAGATGGTACGAGTGAGCTACCGAGAATCGAAGTGCTCAAGTGTGGCTTAAGGTTTTTCAAAGGTGTTGGGAGCAGTGGAAATTATTTAAAGAAGTTGGAAGTGAAAGAAGCTGAACAAAATCTAAGTGCTGAAAAAGTGTCAGAAGATTGGACGTATGGATCAAGTAGCAGATGCAACCATGCTGTCAAAACATGTCCAGAACAGAGGCAAGTGACAGTCACCGCAGAGGTTGAAGCTTCTCCTGAAAAAGCTGACAATGCAGAATTTCAAATCAAGATCACCCCACGTGAAGCTCAACCACAACCACAACCACGCCCATGTTCAAAAACTTTGAAATGGGCATGTTTTACTTGTTGTGACTTCCAAAAACATCTATGA


Protein sequences

Name Description Sequence
propable disease resistance protein propable disease resistance protein [Arabidopsis thaliana].

MEEASSSSEVKALPLPPQHQVFVNFRGEELRNSFVSHLRSALVRHGVNIFIDTNEEKGKPLHVFFQRIEESRIALAIFSVRYTESKWCLNELVKMKECMDKGKLLIIPIFYKVKAYEVRYQKGRFGCVFKNLRNVDVHKKNQWSEALSSVADRIGFSFDGKSDEHNFINGIVEEVKEALSKILLDKTKDAFVYHSKNNSMSVGREKHEIYGLKQRLEELKEKLDLDCEETRILGVVGMPGIGKTTLAREIYETLRCKFLRHGLIQDIRRTSKEHGLDCLPALLLEELLGVTIPDIESTRCAYESYKMELHTHKVLVVLDDVSDKEQIDVLLGRCNWIRQGSRIVIATSDKSLIQDVADYTYVVPQLNHKDGLGHFGRYAFDRHSNIHNNEVIMKLSKEFVHYGRGHPLVLKLLGADLNGKDEDHWKTKLATLAENSSHSIRDVLQVSYDELSQVHKDIFLDIACFRSEDESYIASLLDSSEAASEIKALMNKFMINVSEDRVEMHDLLYTFARELCRRAYAQDGREPHRLWHHQDITDVLKNIEEGAEVRGIFLNMNEMKREMSLDSCTFKSMCGLRYLKIYSSHCPQQCKPNNKINLPDGLNFPLKEVRYLHWLEFPLKEIPPDFNPQNLVDLKLPHSKIERIWSDDKHKDTPKLKWVNLSHSSNLWDISGLSKAQRLVFLNLKGCTSLKSLPEINLVSLEILILSNCSNLKEFRVISQNLETLYLDGTSIKELPLNFNILQRLVILNMKGCAKLKEFPDCLDDLKALKELILSDCWKLQNFPAICERIKVLEILRLDTTTITEIPMISSLQCLCLSKNDHISSLPDNISQLSQLKWLDLKYCKSLTSIPKLPPNLQHLDAHGCCSLKTVSNPLACLTTAQQIYSTFILTNCNKLERSAKEEISSFAQRKCQLLLDAQKRCNVSSLISFSICCYISKIFVSICIFLSISMQNSDSEPLFSICFPGSELPSWFCHEAVGPVLELRMPPHWHENRLAGVALCAVVTFPKSQEQINCFSVKCTFKLEVKEGSWIEFSFPVGRWSNQGNIVANIASEHVFIGYISCSKIFKRLENQYFSSSNPTRSTQSSKCSPTKASLNFMVIDGTSELPRIEVLKCGLRFFKGVGSSGNYLKKLEVKEAEQNLSAEKVSEDWTYGSSSRCNHAVKTCPEQRQVTVTAEVEASPEKADNAEFQIKITPREAQPQPQPRPCSKTLKWACFTCCDFQKHL

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
7-156 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SSEVKALPLPPQHQVFVNFRGEELRNSFVSHLRSALVRHGVNIFIDTNEEKGKPLHVFFQRIEESRIALAIFSVRYTESKWCLNELVKMKECMDKGKLLIIPIFYKVKAYEVRYQKGRFGCVFKNLRNVDVHKKNQWSEALSSVADRIGF

ProfileScan: PS50104
IPR000157
17-153 TIR
Toll/interleukin-1 receptor homology (TIR) domain

PQHQVFVNFRGEELRNSFVSHLRSALVRHGVNIFIDTNEEKGKPLHVFFQRIEESRIALAIFSVRYTESKWCLNELVKMKECMDKGKLLIIPIFYKVKAYEVRYQKGRFGCVFKNLRNVDVHKKNQWSEALSSVADR

Gene3D: G3DSA:3.40.50.10140
18-146 G3DSA:3.40.50.10140

QHQVFVNFRGEELRNSFVSHLRSALVRHGVNIFIDTNEEKGKPLHVFFQRIEESRIALAIFSVRYTESKWCLNELVKMKECMDKGKLLIIPIFYKVKAYEVRYQKGRFGCVFKNLRNVDVHKKNQWSEA

HMMSmart: SM00255
IPR000157
18-153 TIR
Toll/interleukin-1 receptor homology (TIR) domain

QHQVFVNFRGEELRNSFVSHLRSALVRHGVNIFIDTNEEKGKPLHVFFQRIEESRIALAIFSVRYTESKWCLNELVKMKECMDKGKLLIIPIFYKVKAYEVRYQKGRFGCVFKNLRNVDVHKKNQWSEALSSVADR

HMMPfam: PF01582
IPR000157
21-148 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFVNFRGEELRNSFVSHLRSALVRHGVNIFIDTNEEKGKPLHVFFQRIEESRIALAIFSVRYTESKWCLNELVKMKECMDKGKLLIIPIFYKVKAYEVRYQKGRFGCVFKNLRNVDVHKKNQWSEALS

HMMPanther: PTHR11017:SF20
58-1041 PTHR11017:SF20,SUBFAMILY NOT NAMED

GKPLHVFFQRIEESRIALAIFSVRYTESKWCLNELVKMKECMDKGKLLIIPIFYKVKAYEVRYQKGRFGCVFKNLRNVDVHKKNQWSEALSSVADRIGFSFDGKSDEHNFINGIVEEVKEALSKILLDKTKDAFVYHSKNNSMSVGREKHEIYGLKQRLEELKEKLDLDCEETRILGVVGMPGIGKTTLAREIYETLRCKFLRHGLIQDIRRTSKEHGLDCLPALLLEELLGVTIPDIESTRCAYESYKMELHTHKVLVVLDDVSDKEQIDVLLGRCNWIRQGSRIVIATSDKSLIQDVADYTYVVPQLNHKDGLGHFGRYAFDRHSNIHNNEVIMKLSKEFVHYGRGHPLVLKLLGADLNGKDEDHWKTKLATLAENSSHSIRDVLQVSYDELSQVHKDIFLDIACFRSEDESYIASLLDSSEAASEIKALMNKFMINVSEDRVEMHDLLYTFARELCRRAYAQDGREPHRLWHHQDITDVLKNIEEGAEVRGIFLNMNEMKREMSLDSCTFKSMCGLRYLKIYSSHCPQQCKPNNKINLPDGLNFPLKEVRYLHWLEFPLKEIPPDFNPQNLVDLKLPHSKIERIWSDDKHKDTPKLKWVNLSHSSNLWDISGLSKAQRLVFLNLKGCTSLKSLPEINLVSLEILILSNCSNLKEFRVISQNLETLYLDGTSIKELPLNFNILQRLVILNMKGCAKLKEFPDCLDDLKALKELILSDCWKLQNFPAICERIKVLEILRLDTTTITEIPMISSLQCLCLSKNDHISSLPDNISQLSQLKWLDLKYCKSLTSIPKLPPNLQHLDAHGCCSLKTVSNPLACLTTAQQIYSTFILTNCNKLERSAKEEISSFAQRKCQLLLDAQKRCNVSSLISFSICCYISKIFVSICIFLSISMQNSDSEPLFSICFPGSELPSWFCHEAVGPVLELRMPPHWHENRLAGVALCAVVTFPKSQEQINCFSVKCTFKLEVKEGSWIEFSFPVGRW

HMMPanther: PTHR11017
58-1041 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GKPLHVFFQRIEESRIALAIFSVRYTESKWCLNELVKMKECMDKGKLLIIPIFYKVKAYEVRYQKGRFGCVFKNLRNVDVHKKNQWSEALSSVADRIGFSFDGKSDEHNFINGIVEEVKEALSKILLDKTKDAFVYHSKNNSMSVGREKHEIYGLKQRLEELKEKLDLDCEETRILGVVGMPGIGKTTLAREIYETLRCKFLRHGLIQDIRRTSKEHGLDCLPALLLEELLGVTIPDIESTRCAYESYKMELHTHKVLVVLDDVSDKEQIDVLLGRCNWIRQGSRIVIATSDKSLIQDVADYTYVVPQLNHKDGLGHFGRYAFDRHSNIHNNEVIMKLSKEFVHYGRGHPLVLKLLGADLNGKDEDHWKTKLATLAENSSHSIRDVLQVSYDELSQVHKDIFLDIACFRSEDESYIASLLDSSEAASEIKALMNKFMINVSEDRVEMHDLLYTFARELCRRAYAQDGREPHRLWHHQDITDVLKNIEEGAEVRGIFLNMNEMKREMSLDSCTFKSMCGLRYLKIYSSHCPQQCKPNNKINLPDGLNFPLKEVRYLHWLEFPLKEIPPDFNPQNLVDLKLPHSKIERIWSDDKHKDTPKLKWVNLSHSSNLWDISGLSKAQRLVFLNLKGCTSLKSLPEINLVSLEILILSNCSNLKEFRVISQNLETLYLDGTSIKELPLNFNILQRLVILNMKGCAKLKEFPDCLDDLKALKELILSDCWKLQNFPAICERIKVLEILRLDTTTITEIPMISSLQCLCLSKNDHISSLPDNISQLSQLKWLDLKYCKSLTSIPKLPPNLQHLDAHGCCSLKTVSNPLACLTTAQQIYSTFILTNCNKLERSAKEEISSFAQRKCQLLLDAQKRCNVSSLISFSICCYISKIFVSICIFLSISMQNSDSEPLFSICFPGSELPSWFCHEAVGPVLELRMPPHWHENRLAGVALCAVVTFPKSQEQINCFSVKCTFKLEVKEGSWIEFSFPVGRW

Gene3D: G3DSA:3.40.50.300
172-242 G3DSA:3.40.50.300

VEEVKEALSKILLDKTKDAFVYHSKNNSMSVGREKHEIYGLKQRLEELKEKLDLDCEETRILGVVGMPGIG

superfamily: SSF52540
208-440 SSF52540

EIYGLKQRLEELKEKLDLDCEETRILGVVGMPGIGKTTLAREIYETLRCKFLRHGLIQDIRRTSKEHGLDCLPALLLEELLGVTIPDIESTRCAYESYKMELHTHKVLVVLDDVSDKEQIDVLLGRCNWIRQGSRIVIATSDKSLIQDVADYTYVVPQLNHKDGLGHFGRYAFDRHSNIHNNEVIMKLSKEFVHYGRGHPLVLKLLGADLNGKDEDHWKTKLATLAENSSHSI

HMMPfam: PF00931
IPR002182
213-472 NB-ARC,NBS
NB-ARC

KQRLEELKEKLDLDCEETRILGVVGMPGIGKTTLAREIYETLRCKFLRHGLIQDIRRTSKEHGLDCLPALLLEELLGVTIPDIESTRCAYESYKMELHTHKVLVVLDDVSDKEQIDVLLGRCNWIRQGSRIVIATSDKSLIQDVADYTYVVPQLNHKDGLGHFGRYAFDRHSNIHNNEVIMKLSKEFVHYGRGHPLVLKLLGADLNGKDEDHWKTKLATLAENSSHSIRDVLQVSYDELSQVHKDIFLDIACFRSEDESY

FPrintScan: PR00364
IPR000767
232-247 DISEASERSIST
Disease resistance protein

ILGVVGMPGIGKTTLA

Gene3D: G3DSA:3.40.50.300
243-403 G3DSA:3.40.50.300

KTTLAREIYETLRCKFLRHGLIQDIRRTSKEHGLDCLPALLLEELLGVTIPDIESTRCAYESYKMELHTHKVLVVLDDVSDKEQIDVLLGRCNWIRQGSRIVIATSDKSLIQDVADYTYVVPQLNHKDGLGHFGRYAFDRHSNIHNNEVIMKLSKEFVHYG

FPrintScan: PR00364
IPR000767
308-322 DISEASERSIST
Disease resistance protein

ELHTHKVLVVLDDVS

FPrintScan: PR00364
IPR000767
403-417 DISEASERSIST
Disease resistance protein

GRGHPLVLKLLGADL

superfamily: SSF46785
438-541 SSF46785

HSIRDVLQVSYDELSQVHKDIFLDIACFRSEDESYIASLLDSSEAASEIKALMNKFMINVSEDRVEMHDLLYTFARELCRRAYAQDGREPHRLWHHQDITDVLK

superfamily: SSF52058
515-912 SSF52058,LRR

LCRRAYAQDGREPHRLWHHQDITDVLKNIEEGAEVRGIFLNMNEMKREMSLDSCTFKSMCGLRYLKIYSSHCPQQCKPNNKINLPDGLNFPLKEVRYLHWLEFPLKEIPPDFNPQNLVDLKLPHSKIERIWSDDKHKDTPKLKWVNLSHSSNLWDISGLSKAQRLVFLNLKGCTSLKSLPEINLVSLEILILSNCSNLKEFRVISQNLETLYLDGTSIKELPLNFNILQRLVILNMKGCAKLKEFPDCLDDLKALKELILSDCWKLQNFPAICERIKVLEILRLDTTTITEIPMISSLQCLCLSKNDHISSLPDNISQLSQLKWLDLKYCKSLTSIPKLPPNLQHLDAHGCCSLKTVSNPLACLTTAQQIYSTFILTNCNKLERSAKEEISSFAQRKC

Gene3D: G3DSA:3.80.10.10
564-798 G3DSA:3.80.10.10

SLDSCTFKSMCGLRYLKIYSSHCPQQCKPNNKINLPDGLNFPLKEVRYLHWLEFPLKEIPPDFNPQNLVDLKLPHSKIERIWSDDKHKDTPKLKWVNLSHSSNLWDISGLSKAQRLVFLNLKGCTSLKSLPEINLVSLEILILSNCSNLKEFRVISQNLETLYLDGTSIKELPLNFNILQRLVILNMKGCAKLKEFPDCLDDLKALKELILSDCWKLQNFPAICERIKVLEILRL

HMMPfam: PF07725
IPR011713
630-648 LRR_3
Leucine-rich repeat 3

NLVDLKLPHSKIERIWSDD

Gene3D: G3DSA:3.80.10.10
799-880 G3DSA:3.80.10.10

DTTTITEIPMISSLQCLCLSKNDHISSLPDNISQLSQLKWLDLKYCKSLTSIPKLPPNLQHLDAHGCCSLKTVSNPLACLTT

FPrintScan: PR00364
IPR000767
831-847 DISEASERSIST
Disease resistance protein

SQLSQLKWLDLKYCKSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox