PRGDB00047367 (TIR-NBS-LRR type disease resistance protein)

From PRG Wiki
Jump to: navigation, search
TIR-NBS-LRR type disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 105923234 (DQ513251)
Gene Class TNL
Domain Type LRR, NBS, TIR, Others
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa clone 806367 TIR-NBS-LRR type disease resistance protein mRNA, complete cds.

DNA Sequence

ATGAAACGTTCTAAAGTAGCAAGACAGTTCCCTGGACACGAGGACCCTGTTGCCCTTGCCTCACAAACAGCTTTTAGTGTGAGTGAAGTTGAAGCACTTTTTGAACTATACAAGAGCATTAGCAGTTCCGTGGTTGATGATGGGTTAATAAGCAAGATTTTTGAGCTGTTTGATGTTAAGCACAAGGGAGTCATTGATTTCAGTGATTTTGTTAGATCACTCAATGTCTTCCATCCCAATGCCTCACAAGAAGACAAGATAGACTTCTCATTTAAACTATATGATCTGGATAACACGGGATTCATTGAGCGCCAAGAGGTTAAGCAAATGTTGATTGCACTTCTCTGTGAATCGGAAATGAAGTTGGCTGATGAGACTGTTGAGATAATTCTTGATAAGACTTTCTTGGACGCTGATGTAAATAGAGATGGGAAGATAGACAAGTCTGAGTGGGAGAACTTTGTTTGTAGAAACCCATCCTTATTAAAGATAATGACTCTCCCCTACTTGAGACACCTACCTTCACCAACGAGTGCCCGTTCTATGGCTACCAGGAAAAATTCAGACCCATCTTTCTCTTCATCATCATCCGCACCACAATGGAAATATGATGTTTTCTTGAGCTTTAGAGGCGAAGATACCAGGAAGAAGTTCACAGATCATCTTTATACTGCTTTAATCCATGCAGGAATCCATACTTTCAGGGACAATGATGAGCTTCCTAGAGGAGAAGACATTTCTTCTATAATCTCAAGACCAATTCAAGAATCAAGAATTGCTATTGTGGTCTTCTCAAAAGGCTATGCTTCCTCCACCTGGTGTCTCGGTGAACTTTCAGAGATTCTAGCGTGCAAAAGTGCCATTGGTCAACTTGCTGTCCCTATCTTCTATGACATCGATCCCTCCGATGTTAGAAAACAGACAGCAAGTTTTGCAGAAGCTTTTAAGAGACATGAAGAACGGTTTAAGGAAAATATTGAGATGGTCAACAAGTGGAGAAAAGTTCTCGTGGAGGCTGCAAATCTTTCTGGATGGCATCTCCAAGAAATGGAAAATGGACACGAAGCAAAGTTTATTGAAAAAATGGTTGAAGATGTTTTACATAAACTGAACTGCAAATACTTGACTGTTGCCTCATACCCAGTAGGTATTGATTCTCGAGTTAAGGACGTAGTTTCCATGTTAAGTGTTTATACAGATGATGTCCGAACAGTGGGCATATATGGGATGGGAGGTATAGGGAAGACAACCATAGCAAAGGCCGTATTTAACGAACTTTGCAATGAATTCGAAGGAAGTTGTTGTCTTTTGAATATCAAAGAAATCTCAGAACAACCCAGTGGTCTTGTTCAATTACAAGAACAACTCATTTCTGATCTCATACAATCAAAAACCTTTAAGATTAATAATGTTGATAGAGGAAGCGCTCTGATCAAAGAAAGACTTTGTCACAAAAGAGTTCTTGTTGTTCTTGACGACTTGGATCAGTTGAAACAACTAGGAGCACTGATGGGAGAGAGAAATTGGTTTGGCCTTGGAAGTAGAGTAATTATTACAACAAGAGACGAACATTTGCTAACTCAACTTCAAGTGCACAATAAATATCTTGTTGAAGAATTGAATCATGACGAGTCCCTTCAGCTTTTCATTGCACATGCCTTCAAGGAGAATCGTCCAACAGAAGAATTTCTGGGGATTTCTAAAGGTGTAGTTCAGTATGTTGGAGGACTTCCACTGGCTCTTGAAGTTTTGGGTTCTTATTTGTGCAAAAGAAGCATAGGTGAATGGAGAAGTGCTAGAAAACTTCAAATAAGTTTCAATGCACTCGATGATGATGATATAAAGGGTATATTCCTTGATATCACATGTTTCTTTATTGGTATGGACGTGGATTATGTTTCAAAATTACTTGATGGCTGTGGTTTCCACTCTAGAATTGGTATTGAGGTTCTAATGCAGAGATCACTTATAACAACTAACTGGTATAATAAGTTAAGGATGCATGATCTATTACGAGATATGGGAAGGGAGATCATCCGTGAAATGTCACCTGACCATCCAGGAAAACGCCGCAGACTTTGTTTTCAGAAGGATGTGCTGGATGCACTCAGGAAAAAGATGTTTCTCAACAGGCTGAAAATCCTCAACCTCAGCTATTCTGTGCACCTTTCTACACCACCGCACTTCATGGGACTCCCTTGTCTGGAGAGAATTATACTTGAAGGTTGCACAAGTTTAGTTGAGGTTCATCAATCTATTGGACATTTGGATAGCCTGACTTTGTTGAATCTGGAGGGATGCAAGAGTCTGAAGAATCTTCCAGAAAGCATTTGCTACTTGAAATGCCTTGAAAGTCTAAACATTTCCAGGTGCATAAACCTTGAGAAATTGCCCGATCAGTTGGGTGATATGGAAGCCTTAACCATGCTTCTAGCAGATGGAACTGCAATTGAGCGACTACCATCTTCCATTGGACATTTGAAGAACCTCAGTAATTTATCGTTGGGTGGATTCAAATATGACTTATCATCAGTATCTTGGTTTTCACATATTTTACCTTGGCTTTCACCAAGAATTTCAAACCCCAGAGCTTTGCTTCCAACTTTTACTGGCTTAAACTCATTGAGAAGACTAGATCTGAGTTACTGTGGTCTATCTGATGGGACAGATCTTGGGGGGTTATCCTCACTTCAAGAATTGAATTTCACGAGAAACAAGCTCAATAATCTGCCTAATGGCATAGATAGACTTCCCGAGCTACAAGTATTGTGCCTGTACCATTGTGCAGATCTTCTATCAATCTCAGATCTTCCCTCAACTTTGCACTCTTTGATGGTGTATCATTGCACATCCATAGAAAGATTATCTATTCATTCGAAAAACGTACCAGATATGTATCTAGTTAATTGCCAACAACTATCTGATATTCAGGGTTTAGGAAGCGTGGGAAATAAACCACTCATTTATGTTGACAACTGCAGCAAACTGGCAAATAATTTCAAGAGTCTTCTTCAGGCATCGTTCAAGGGCGAGCATCTTGACATTTGCCTCCGCGACAGTGAGATACCGGATTGGTTCAGTCATCGTGGAGATGGATCATCGATATCTTTTTATGTACCAGACAGTGAAATTCAAGGATTGATTGTCTGGATTGTCTGCGGAGCTAGCGAAAGAAGACTTCCCCTACCTTACGCTTCTGCCACGATTAGAAATAAGAGCAAAGGTGTTCGATTGTTTCATTGGTCAACATTTATCCCGCTATATTATTCAAAACCTGCATATCATTCTTGGGTGAACTATGTAACATTTAGTCGGCTTCCATGTGCAATGGAAGGTGGAGAAGTAGTGGAACACTCTGTCAAAATAACCAATGGCGTTGTTGTGGACAAGTGTGGCGTCCATCTGATATCAAAAGAGTGA


Protein sequences

Name Description Sequence
TIR-NBS-LRR type disease resistance protein TIR-NBS-LRR type disease resistance protein [Populus trichocarpa].

MKRSKVARQFPGHEDPVALASQTAFSVSEVEALFELYKSISSSVVDDGLISKIFELFDVKHKGVIDFSDFVRSLNVFHPNASQEDKIDFSFKLYDLDNTGFIERQEVKQMLIALLCESEMKLADETVEIILDKTFLDADVNRDGKIDKSEWENFVCRNPSLLKIMTLPYLRHLPSPTSARSMATRKNSDPSFSSSSSAPQWKYDVFLSFRGEDTRKKFTDHLYTALIHAGIHTFRDNDELPRGEDISSIISRPIQESRIAIVVFSKGYASSTWCLGELSEILACKSAIGQLAVPIFYDIDPSDVRKQTASFAEAFKRHEERFKENIEMVNKWRKVLVEAANLSGWHLQEMENGHEAKFIEKMVEDVLHKLNCKYLTVASYPVGIDSRVKDVVSMLSVYTDDVRTVGIYGMGGIGKTTIAKAVFNELCNEFEGSCCLLNIKEISEQPSGLVQLQEQLISDLIQSKTFKINNVDRGSALIKERLCHKRVLVVLDDLDQLKQLGALMGERNWFGLGSRVIITTRDEHLLTQLQVHNKYLVEELNHDESLQLFIAHAFKENRPTEEFLGISKGVVQYVGGLPLALEVLGSYLCKRSIGEWRSARKLQISFNALDDDDIKGIFLDITCFFIGMDVDYVSKLLDGCGFHSRIGIEVLMQRSLITTNWYNKLRMHDLLRDMGREIIREMSPDHPGKRRRLCFQKDVLDALRKKMFLNRLKILNLSYSVHLSTPPHFMGLPCLERIILEGCTSLVEVHQSIGHLDSLTLLNLEGCKSLKNLPESICYLKCLESLNISRCINLEKLPDQLGDMEALTMLLADGTAIERLPSSIGHLKNLSNLSLGGFKYDLSSVSWFSHILPWLSPRISNPRALLPTFTGLNSLRRLDLSYCGLSDGTDLGGLSSLQELNFTRNKLNNLPNGIDRLPELQVLCLYHCADLLSISDLPSTLHSLMVYHCTSIERLSIHSKNVPDMYLVNCQQLSDIQGLGSVGNKPLIYVDNCSKLANNFKSLLQASFKGEHLDICLRDSEIPDWFSHRGDGSSISFYVPDSEIQGLIVWIVCGASERRLPLPYASATIRNKSKGVRLFHWSTFIPLYYSKPAYHSWVNYVTFSRLPCAMEGGEVVEHSVKITNGVVVDKCGVHLISKE

Domains

Domain Start-End Description Sequence

superfamily: SSF47473
15-172 SSF47473

DPVALASQTAFSVSEVEALFELYKSISSSVVDDGLISKIFELFDVKHKGVIDFSDFVRSLNVFHPNASQEDKIDFSFKLYDLDNTGFIERQEVKQMLIALLCESEMKLADETVEIILDKTFLDADVNRDGKIDKSEWENFVCRNPSLLKIMTLPYLRH

Gene3D: G3DSA:1.10.238.10
IPR011992
19-169 EF-Hand_type
EF-hand-like domain

LASQTAFSVSEVEALFELYKSISSSVVDDGLISKIFELFDVKHKGVIDFSDFVRSLNVFHPNASQEDKIDFSFKLYDLDNTGFIERQEVKQMLIALLCESEMKLADETVEIILDKTFLDADVNRDGKIDKSEWENFVCRNPSLLKIMTLPY

ProfileScan: PS50222
IPR018249
45-80 EF_HAND_2
EF-HAND 2

VDDGLISKIFELFDVKHKGVIDFSDFVRSLNVFHPN

HMMSmart: SM00054
IPR002048
49-77 EFh
Calcium-binding EF-hand

LISKIFELFDVKHKGVIDFSDFVRSLNVF

ProfileScan: PS50222
IPR018249
82-117 EF_HAND_2
EF-HAND 2

SQEDKIDFSFKLYDLDNTGFIERQEVKQMLIALLCE

HMMSmart: SM00054
IPR002048
86-114 EFh
Calcium-binding EF-hand

KIDFSFKLYDLDNTGFIERQEVKQMLIAL

HMMPfam: PF13499
90-154 EF_hand_5,EF-hand domain pair

SFKLYDLDNTGFIERQEVKQMLIALLCESEMKLADETVEIILDKTFLDADVNRDGKIDKSEWENF

PatternScan: PS00018
IPR018247
95-107 EF_HAND_1
EF-Hand 1, calcium-binding site

DLDNTGFIERQEV

ProfileScan: PS50222
IPR018249
126-161 EF_HAND_2
EF-HAND 2

TVEIILDKTFLDADVNRDGKIDKSEWENFVCRNPSL

HMMSmart: SM00054
IPR002048
130-158 EFh
Calcium-binding EF-hand

ILDKTFLDADVNRDGKIDKSEWENFVCRN

PatternScan: PS00018
IPR018247
139-151 EF_HAND_1
EF-Hand 1, calcium-binding site

DVNRDGKIDKSEW

superfamily: SSF52200
IPR000157
191-345 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SFSSSSSAPQWKYDVFLSFRGEDTRKKFTDHLYTALIHAGIHTFRDNDELPRGEDISSIISRPIQESRIAIVVFSKGYASSTWCLGELSEILACKSAIGQLAVPIFYDIDPSDVRKQTASFAEAFKRHEERFKENIEMVNKWRKVLVEAANLSGW

Gene3D: G3DSA:3.40.50.10140
200-333 G3DSA:3.40.50.10140

QWKYDVFLSFRGEDTRKKFTDHLYTALIHAGIHTFRDNDELPRGEDISSIISRPIQESRIAIVVFSKGYASSTWCLGELSEILACKSAIGQLAVPIFYDIDPSDVRKQTASFAEAFKRHEERFKENIEMVNKWR

ProfileScan: PS50104
IPR000157
201-342 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WKYDVFLSFRGEDTRKKFTDHLYTALIHAGIHTFRDNDELPRGEDISSIISRPIQESRIAIVVFSKGYASSTWCLGELSEILACKSAIGQLAVPIFYDIDPSDVRKQTASFAEAFKRHEERFKENIEMVNKWRKVLVEAANL

HMMSmart: SM00255
IPR000157
202-342 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KYDVFLSFRGEDTRKKFTDHLYTALIHAGIHTFRDNDELPRGEDISSIISRPIQESRIAIVVFSKGYASSTWCLGELSEILACKSAIGQLAVPIFYDIDPSDVRKQTASFAEAFKRHEERFKENIEMVNKWRKVLVEAANL

HMMPfam: PF01582
IPR000157
205-337 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGEDTRKKFTDHLYTALIHAGIHTFRDNDELPRGEDISSIISRPIQESRIAIVVFSKGYASSTWCLGELSEILACKSAIGQLAVPIFYDIDPSDVRKQTASFAEAFKRHEERFKENIEMVNKWRKVLV

HMMPanther: PTHR11017
230-946 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GIHTFRDNDELPRGEDISSIISRPIQESRIAIVVFSKGYASSTWCLGELSEILACKSAIGQLAVPIFYDIDPSDVRKQTASFAEAFKRHEERFKENIEMVNKWRKVLVEAANLSGWHLQEMENGHEAKFIEKMVEDVLHKLNCKYLTVASYPVGIDSRVKDVVSMLSVYTDDVRTVGIYGMGGIGKTTIAKAVFNELCNEFEGSCCLLNIKEISEQPSGLVQLQEQLISDLIQSKTFKINNVDRGSALIKERLCHKRVLVVLDDLDQLKQLGALMGERNWFGLGSRVIITTRDEHLLTQLQVHNKYLVEELNHDESLQLFIAHAFKENRPTEEFLGISKGVVQYVGGLPLALEVLGSYLCKRSIGEWRSARKLQISFNALDDDDIKGIFLDITCFFIGMDVDYVSKLLDGCGFHSRIGIEVLMQRSLITTNWYNKLRMHDLLRDMGREIIREMSPDHPGKRRRLCFQKDVLDALRKKMFLNRLKILNLSYSVHLSTPPHFMGLPCLERIILEGCTSLVEVHQSIGHLDSLTLLNLEGCKSLKNLPESICYLKCLESLNISRCINLEKLPDQLGDMEALTMLLADGTAIERLPSSIGHLKNLSNLSLGGFKYDLSSVSWFSHILPWLSPRISNPRALLPTFTGLNSLRRLDLSYCGLSDGTDLGGLSSLQELNFTRNKLNNLPNGIDRLPELQVLCLYHCADLLSISDLPSTLHSLMV

HMMPanther: PTHR11017:SF130
230-946 PTHR11017:SF130,DISEASE RESISTANCE PROTEIN (TIR-NBS-LRR CLASS)

GIHTFRDNDELPRGEDISSIISRPIQESRIAIVVFSKGYASSTWCLGELSEILACKSAIGQLAVPIFYDIDPSDVRKQTASFAEAFKRHEERFKENIEMVNKWRKVLVEAANLSGWHLQEMENGHEAKFIEKMVEDVLHKLNCKYLTVASYPVGIDSRVKDVVSMLSVYTDDVRTVGIYGMGGIGKTTIAKAVFNELCNEFEGSCCLLNIKEISEQPSGLVQLQEQLISDLIQSKTFKINNVDRGSALIKERLCHKRVLVVLDDLDQLKQLGALMGERNWFGLGSRVIITTRDEHLLTQLQVHNKYLVEELNHDESLQLFIAHAFKENRPTEEFLGISKGVVQYVGGLPLALEVLGSYLCKRSIGEWRSARKLQISFNALDDDDIKGIFLDITCFFIGMDVDYVSKLLDGCGFHSRIGIEVLMQRSLITTNWYNKLRMHDLLRDMGREIIREMSPDHPGKRRRLCFQKDVLDALRKKMFLNRLKILNLSYSVHLSTPPHFMGLPCLERIILEGCTSLVEVHQSIGHLDSLTLLNLEGCKSLKNLPESICYLKCLESLNISRCINLEKLPDQLGDMEALTMLLADGTAIERLPSSIGHLKNLSNLSLGGFKYDLSSVSWFSHILPWLSPRISNPRALLPTFTGLNSLRRLDLSYCGLSDGTDLGGLSSLQELNFTRNKLNNLPNGIDRLPELQVLCLYHCADLLSISDLPSTLHSLMV

superfamily: SSF52540
364-598 SSF52540

EDVLHKLNCKYLTVASYPVGIDSRVKDVVSMLSVYTDDVRTVGIYGMGGIGKTTIAKAVFNELCNEFEGSCCLLNIKEISEQPSGLVQLQEQLISDLIQSKTFKINNVDRGSALIKERLCHKRVLVVLDDLDQLKQLGALMGERNWFGLGSRVIITTRDEHLLTQLQVHNKYLVEELNHDESLQLFIAHAFKENRPTEEFLGISKGVVQYVGGLPLALEVLGSYLCKRSIGEWRS

HMMPfam: PF00931
IPR002182
385-638 NB-ARC,NBS
NB-ARC

DSRVKDVVSMLSVYTDDVRTVGIYGMGGIGKTTIAKAVFNELCNEFEGSCCLLNIKEISEQPSGLVQLQEQLISDLIQSKTFKINNVDRGSALIKERLCHKRVLVVLDDLDQLKQLGALMGERNWFGLGSRVIITTRDEHLLTQLQVHNKYLVEELNHDESLQLFIAHAFKENRPTEEFLGISKGVVQYVGGLPLALEVLGSYLCKRSIGEWRSARKLQISFNALDDDDIKGIFLDITCFFIGMDVDYVSKLLD

HMMSmart: SM00382
IPR003593
401-537 AAA,NBS
AAA+ ATPase domain

DVRTVGIYGMGGIGKTTIAKAVFNELCNEFEGSCCLLNIKEISEQPSGLVQLQEQLISDLIQSKTFKINNVDRGSALIKERLCHKRVLVVLDDLDQLKQLGALMGERNWFGLGSRVIITTRDEHLLTQLQVHNKYLV

Gene3D: G3DSA:3.40.50.300
403-529 G3DSA:3.40.50.300

RTVGIYGMGGIGKTTIAKAVFNELCNEFEGSCCLLNIKEISEQPSGLVQLQEQLISDLIQSKTFKINNVDRGSALIKERLCHKRVLVVLDDLDQLKQLGALMGERNWFGLGSRVIITTRDEHLLTQL

FPrintScan: PR00364
IPR000767
404-419 DISEASERSIST
Disease resistance protein

TVGIYGMGGIGKTTIA

FPrintScan: PR00364
IPR000767
481-495 DISEASERSIST
Disease resistance protein

RLCHKRVLVVLDDLD

FPrintScan: PR00364
IPR000767
574-588 DISEASERSIST
Disease resistance protein

VGGLPLALEVLGSYL

superfamily: SSF46785
596-704 SSF46785

WRSARKLQISFNALDDDDIKGIFLDITCFFIGMDVDYVSKLLDGCGFHSRIGIEVLMQRSLITTNWYNKLRMHDLLRDMGREIIREMSPDHPGKRRRLCFQKDVLDALR

superfamily: SSF52058
666-985 SSF52058,LRR

RMHDLLRDMGREIIREMSPDHPGKRRRLCFQKDVLDALRKKMFLNRLKILNLSYSVHLSTPPHFMGLPCLERIILEGCTSLVEVHQSIGHLDSLTLLNLEGCKSLKNLPESICYLKCLESLNISRCINLEKLPDQLGDMEALTMLLADGTAIERLPSSIGHLKNLSNLSLGGFKYDLSSVSWFSHILPWLSPRISNPRALLPTFTGLNSLRRLDLSYCGLSDGTDLGGLSSLQELNFTRNKLNNLPNGIDRLPELQVLCLYHCADLLSISDLPSTLHSLMVYHCTSIERLSIHSKNVPDMYLVNCQQLSDIQGLGSVGNK

Gene3D: G3DSA:3.80.10.10
709-929 G3DSA:3.80.10.10

LNRLKILNLSYSVHLSTPPHFMGLPCLERIILEGCTSLVEVHQSIGHLDSLTLLNLEGCKSLKNLPESICYLKCLESLNISRCINLEKLPDQLGDMEALTMLLADGTAIERLPSSIGHLKNLSNLSLGGFKYDLSSVSWFSHILPWLSPRISNPRALLPTFTGLNSLRRLDLSYCGLSDGTDLGGLSSLQELNFTRNKLNNLPNGIDRLPELQVLCLYHCA

FPrintScan: PR00364
IPR000767
754-770 DISEASERSIST
Disease resistance protein

GHLDSLTLLNLEGCKSL

HMMPfam: PF00560
IPR001611
783-802 LRR_1
Leucine-rich repeat

LESLNISRCINLEKLPDQLG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox