PRGDB00047378 (TIR-NBS-LRR type disease resistance protein)

From PRG Wiki
Jump to: navigation, search
TIR-NBS-LRR type disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 105923066 (DQ513240)
Gene Class TNL
Domain Type LRR, LRR, LRR, NBS, LRR, TIR, Others
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa clone 13762 TIR-NBS-LRR type disease resistance protein mRNA, partial cds.

DNA Sequence

GAAGGTGCCTCTGCTTCCCAATGCGCGTTCGATATCCCTTTCATTTCTCTTTTTACTTTTTCCCCACCGAAACTCCATCTTCTTTACAGTGTAAGAAAAAGATCCGTAAGGAAACTTACCAGTACGATTTTAGAGACAAAGACACCCGGAACAACTTTACTAGTCATCTATATTCTAATCTGAAACAGAGAGGCGTCGATGTATATATGGATGATAGGGAGCTCGAGAGAGGAAAGACCATCGAACCTGCTCTCTGGAAGGCCATCGAAGAATCAAGGAATGAGTCGGAATCAATTAAAATAATTGCTGAATACATATCGTACAAACTAAGCATCACTCTGCCAACAATTAGCAAAAAATTAGTTGGAATAGATTCTCGCCTACAGGTATTAAATGGCTATATAGGTGAAGAAGTAGGCAAAGCAATCTTCATAGGGATTTGTGGAATGGGTGGCTTGGGTAAGACGACTGTTGCAAGGGTAGTATATGATAGGATTCGTTGGCAATTTGAAGGCAGCTGCTTCTTAGCGAATGTCAAAGAAGATTTTGCTAGGGAAGACGGACCACGTCGTTTGCAGGAACAACTTCTTTCTGAAATCTTAATGGAACGTGCTTCTGTATGGGATTCTTATAGAGGGATTGAGATGATAAAGCGGAGGTTACGACTTAAAAAGATTCTTCTTATCCTTGATGATGTAGATGAAAAAGAACAACTAGAATTCCTGGCTGCGGAGAGTAAATGGTTTGGTCCAGGGAGCAGAATTATCATAACAAGCAGAGATAAACAAGTGTTGACTAGAAATGGTGTTGCTAGAATTTATGAGGCTGAGAAATTGAATGATGATGATGCTCTTACGTTGTTTAGCCAGAAAGCTTTCAAAAATGACCAACCTGCTGAAGATTTCGTGGAACTATCCAAGCAAGTTGTGGGTTATGCTACTGGCCTTCCACTGGCTCTTGAAGTTATAGGTTCCTTTATGCATGGAAGAAGTATCCTTGAATGGGGAAGTGCGATTAATAGACTAAATGATATTCCTGACCGTGAAATTATTGATGTGCTTCGGATTAGTTTTGATGGTCTCCATGAATCAGATAAGAAAATATTTTTAGACATTGCATGTTTCCTGATGGGGTTTAAAATTGATCGAATAACAAGGATACTTGAAAGCCGTGGATTCAATGCAGGTATTGGAATATCAGTTCTTATTGAGAGATCTCTCATAAGTGTCTCTCGGGATCAAGTCTGGATGCATAATTTATTACAGATAATGGGTAAGGAAATTGTTCGTTGTGAATCCCCTGAAGAGCCTGGAAGGCGCAGTAGATTGTGGACATACAAGGATGTCTGCCTTGCACTGATGGACAACACAGGAAAAGAAAAAATAGAAGCCATTTTCTTGGACATGCCTGGAATAAAAGAGGCACAATGGAACATGAAAGCCTTCTCTAAAATGAGCAGATTAAGATTGCTCAAAATCCACAACGTGCAGCTTTCTGAAGGACCTGAAGCTCTTTCCAACGAGTTACGATTTCTTGAATGGAATTCTTACCCTTCAAAATCATTGCCAGCTTGTTTCCAGATGGATGAGCTAGTTGAACTTCACATGGCTAACAGTAGTATTGAGCAATTATGGTATGGGTATAAGAGTGCAGTTAATTTGAAAATCATCAATCTCAGCAACTCACTAAACCTGATCAAGACTCCAGATCTTACTGGAATTCTGAATCTCGAGAGTCTAATTCTTGAAGGATGTACAAGTTTGTCAGAGGTCCATCCATCACTTGCACATCACAAGAAGCTTCAATATGTGAATCTTGTGAAGTGCAAAAGTATTAGGATTCTCCCAAACAACCTAGAAATGGAATCACTTAAAGTTTGCACTCTTGATGGCTGCTCAAAACTTGAGAAGTTTCCAGATATAGTAGGAAACATGAACTGTTTGACGGTGCTATGTTTGGATGAGACTGGTATTACAAAACTATGTTCATCGATTCATCATTTGATTGGCTTAGGTCTATTGAGCATGAACAGCTGCAAGAACCTTGAAAGCATTCCAAGTAGCATAGGTTGTTTGAAATCCCTTAAAAAACTTGATCTGTCTGGCTGCTCTGAACTTAAATATATACCAGAGAATTTGGGGAAAGTTGAAAGTTTGGAGGAGTTTGATGTAAGTGGAACTTCAATTAGACAATTGCCAGCATCCATTTTTCTTTTAAAGAATCTTAAAGTATTATCTTCGGATGGATGTGAAAGAATAGCTAAGCTGCCTTCTTATTCTGGTTTGTCTAATCCAAGACCTGGATTTGGTATCGCTATTCCAGGAAATGAAATTCCAGGCTGGTTTAACCATCAATTTTTTTATGATGTCGAACAGTCAAAGATAGATGATCGAACAAAGAGTTACACAATTGTCTTTGATAAGAATGAAGAAAATCTCAGGGAAAACGAGGAGAAGGTACAAAGATGGACGAATATTCTTAGTGAAGTTCAGATTTCATCTGGATCAAGATCATTGAAAAGCGGCATAGGAGCTCCACCAACGCAGCAGCAGCAGATCCACCAGCTCCAGCTCCACCAGAAGCAGCAGCGGATCCAGCTTCTCCGGCTGCTCGAGGAGCGGCGGCGGCTGCTCCAGCAGCTTGAGCGGCGGCAGCGGATCCAGAAGCACGAGCTCGCGCAGCTGCTCTCTGAGAAGCAGCTGTTTGAGAAGCTGCTGTCTGAGCAGCAGCTGCTTGAGCAGCAGCTGCATGAGTTTTGA


Protein sequences

Name Description Sequence
TIR-NBS-LRR type disease resistance protein TIR-NBS-LRR type disease resistance protein [Populus trichocarpa].

RCLCFPMRVRYPFHFSFYFFPTETPSSLQCKKKIRKETYQYDFRDKDTRNNFTSHLYSNLKQRGVDVYMDDRELERGKTIEPALWKAIEESRNESESIKIIAEYISYKLSITLPTISKKLVGIDSRLQVLNGYIGEEVGKAIFIGICGMGGLGKTTVARVVYDRIRWQFEGSCFLANVKEDFAREDGPRRLQEQLLSEILMERASVWDSYRGIEMIKRRLRLKKILLILDDVDEKEQLEFLAAESKWFGPGSRIIITSRDKQVLTRNGVARIYEAEKLNDDDALTLFSQKAFKNDQPAEDFVELSKQVVGYATGLPLALEVIGSFMHGRSILEWGSAINRLNDIPDREIIDVLRISFDGLHESDKKIFLDIACFLMGFKIDRITRILESRGFNAGIGISVLIERSLISVSRDQVWMHNLLQIMGKEIVRCESPEEPGRRSRLWTYKDVCLALMDNTGKEKIEAIFLDMPGIKEAQWNMKAFSKMSRLRLLKIHNVQLSEGPEALSNELRFLEWNSYPSKSLPACFQMDELVELHMANSSIEQLWYGYKSAVNLKIINLSNSLNLIKTPDLTGILNLESLILEGCTSLSEVHPSLAHHKKLQYVNLVKCKSIRILPNNLEMESLKVCTLDGCSKLEKFPDIVGNMNCLTVLCLDETGITKLCSSIHHLIGLGLLSMNSCKNLESIPSSIGCLKSLKKLDLSGCSELKYIPENLGKVESLEEFDVSGTSIRQLPASIFLLKNLKVLSSDGCERIAKLPSYSGLSNPRPGFGIAIPGNEIPGWFNHQFFYDVEQSKIDDRTKSYTIVFDKNEENLRENEEKVQRWTNILSEVQISSGSRSLKSGIGAPPTQQQQIHQLQLHQKQQRIQLLRLLEERRRLLQQLERRQRIQKHELAQLLSEKQLFEKLLSEQQLLEQQLHEF

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
29-92 TIR
Toll/interleukin-1 receptor homology (TIR) domain

QCKKKIRKETYQYDFRDKDTRNNFTSHLYSNLKQRGVDVYMDDRELERGKTIEPALWKAIEESR

HMMPanther: PTHR11017
34-756 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

IRKETYQYDFRDKDTRNNFTSHLYSNLKQRGVDVYMDDRELERGKTIEPALWKAIEESRNESESIKIIAEYISYKLSITLPTISKKLVGIDSRLQVLNGYIGEEVGKAIFIGICGMGGLGKTTVARVVYDRIRWQFEGSCFLANVKEDFAREDGPRRLQEQLLSEILMERASVWDSYRGIEMIKRRLRLKKILLILDDVDEKEQLEFLAAESKWFGPGSRIIITSRDKQVLTRNGVARIYEAEKLNDDDALTLFSQKAFKNDQPAEDFVELSKQVVGYATGLPLALEVIGSFMHGRSILEWGSAINRLNDIPDREIIDVLRISFDGLHESDKKIFLDIACFLMGFKIDRITRILESRGFNAGIGISVLIERSLISVSRDQVWMHNLLQIMGKEIVRCESPEEPGRRSRLWTYKDVCLALMDNTGKEKIEAIFLDMPGIKEAQWNMKAFSKMSRLRLLKIHNVQLSEGPEALSNELRFLEWNSYPSKSLPACFQMDELVELHMANSSIEQLWYGYKSAVNLKIINLSNSLNLIKTPDLTGILNLESLILEGCTSLSEVHPSLAHHKKLQYVNLVKCKSIRILPNNLEMESLKVCTLDGCSKLEKFPDIVGNMNCLTVLCLDETGITKLCSSIHHLIGLGLLSMNSCKNLESIPSSIGCLKSLKKLDLSGCSELKYIPENLGKVESLEEFDVSGTSIRQLPASIFLLKNLKVLSSDGCERIAKLP

HMMPanther: PTHR11017:SF20
34-756 PTHR11017:SF20,SUBFAMILY NOT NAMED

IRKETYQYDFRDKDTRNNFTSHLYSNLKQRGVDVYMDDRELERGKTIEPALWKAIEESRNESESIKIIAEYISYKLSITLPTISKKLVGIDSRLQVLNGYIGEEVGKAIFIGICGMGGLGKTTVARVVYDRIRWQFEGSCFLANVKEDFAREDGPRRLQEQLLSEILMERASVWDSYRGIEMIKRRLRLKKILLILDDVDEKEQLEFLAAESKWFGPGSRIIITSRDKQVLTRNGVARIYEAEKLNDDDALTLFSQKAFKNDQPAEDFVELSKQVVGYATGLPLALEVIGSFMHGRSILEWGSAINRLNDIPDREIIDVLRISFDGLHESDKKIFLDIACFLMGFKIDRITRILESRGFNAGIGISVLIERSLISVSRDQVWMHNLLQIMGKEIVRCESPEEPGRRSRLWTYKDVCLALMDNTGKEKIEAIFLDMPGIKEAQWNMKAFSKMSRLRLLKIHNVQLSEGPEALSNELRFLEWNSYPSKSLPACFQMDELVELHMANSSIEQLWYGYKSAVNLKIINLSNSLNLIKTPDLTGILNLESLILEGCTSLSEVHPSLAHHKKLQYVNLVKCKSIRILPNNLEMESLKVCTLDGCSKLEKFPDIVGNMNCLTVLCLDETGITKLCSSIHHLIGLGLLSMNSCKNLESIPSSIGCLKSLKKLDLSGCSELKYIPENLGKVESLEEFDVSGTSIRQLPASIFLLKNLKVLSSDGCERIAKLP

HMMPfam: PF01582
IPR000157
43-92 TIR
Toll/interleukin-1 receptor homology (TIR) domain

FRDKDTRNNFTSHLYSNLKQRGVDVYMDDRELERGKTIEPALWKAIEESR

Gene3D: G3DSA:3.40.50.10140
43-93 G3DSA:3.40.50.10140

FRDKDTRNNFTSHLYSNLKQRGVDVYMDDRELERGKTIEPALWKAIEESRN

ProfileScan: PS50104
IPR000157
43-92 TIR
Toll/interleukin-1 receptor homology (TIR) domain

FRDKDTRNNFTSHLYSNLKQRGVDVYMDDRELERGKTIEPALWKAIEESR

superfamily: SSF52540
103-349 SSF52540

EYISYKLSITLPTISKKLVGIDSRLQVLNGYIGEEVGKAIFIGICGMGGLGKTTVARVVYDRIRWQFEGSCFLANVKEDFAREDGPRRLQEQLLSEILMERASVWDSYRGIEMIKRRLRLKKILLILDDVDEKEQLEFLAAESKWFGPGSRIIITSRDKQVLTRNGVARIYEAEKLNDDDALTLFSQKAFKNDQPAEDFVELSKQVVGYATGLPLALEVIGSFMHGRSILEWGSAINRLNDIPDREI

HMMPfam: PF00931
IPR002182
139-381 NB-ARC,NBS
NB-ARC

GKAIFIGICGMGGLGKTTVARVVYDRIRWQFEGSCFLANVKEDFAREDGPRRLQEQLLSEILMERASVWDSYRGIEMIKRRLRLKKILLILDDVDEKEQLEFLAAESKWFGPGSRIIITSRDKQVLTRNGVARIYEAEKLNDDDALTLFSQKAFKNDQPAEDFVELSKQVVGYATGLPLALEVIGSFMHGRSILEWGSAINRLNDIPDREIIDVLRISFDGLHESDKKIFLDIACFLMGFKID

Gene3D: G3DSA:3.40.50.300
140-263 G3DSA:3.40.50.300

KAIFIGICGMGGLGKTTVARVVYDRIRWQFEGSCFLANVKEDFAREDGPRRLQEQLLSEILMERASVWDSYRGIEMIKRRLRLKKILLILDDVDEKEQLEFLAAESKWFGPGSRIIITSRDKQV

FPrintScan: PR00364
IPR000767
143-158 DISEASERSIST
Disease resistance protein

FIGICGMGGLGKTTVA

FPrintScan: PR00364
IPR000767
219-233 DISEASERSIST
Disease resistance protein

RLRLKKILLILDDVD

FPrintScan: PR00364
IPR000767
312-326 DISEASERSIST
Disease resistance protein

ATGLPLALEVIGSFM

superfamily: SSF46785
347-453 SSF46785

REIIDVLRISFDGLHESDKKIFLDIACFLMGFKIDRITRILESRGFNAGIGISVLIERSLISVSRDQVWMHNLLQIMGKEIVRCESPEEPGRRSRLWTYKDVCLALM

superfamily: SSF52058
427-763 SSF52058,LRR

IVRCESPEEPGRRSRLWTYKDVCLALMDNTGKEKIEAIFLDMPGIKEAQWNMKAFSKMSRLRLLKIHNVQLSEGPEALSNELRFLEWNSYPSKSLPACFQMDELVELHMANSSIEQLWYGYKSAVNLKIINLSNSLNLIKTPDLTGILNLESLILEGCTSLSEVHPSLAHHKKLQYVNLVKCKSIRILPNNLEMESLKVCTLDGCSKLEKFPDIVGNMNCLTVLCLDETGITKLCSSIHHLIGLGLLSMNSCKNLESIPSSIGCLKSLKKLDLSGCSELKYIPENLGKVESLEEFDVSGTSIRQLPASIFLLKNLKVLSSDGCERIAKLPSYSGLSN

Gene3D: G3DSA:3.80.10.10
466-761 G3DSA:3.80.10.10

LDMPGIKEAQWNMKAFSKMSRLRLLKIHNVQLSEGPEALSNELRFLEWNSYPSKSLPACFQMDELVELHMANSSIEQLWYGYKSAVNLKIINLSNSLNLIKTPDLTGILNLESLILEGCTSLSEVHPSLAHHKKLQYVNLVKCKSIRILPNNLEMESLKVCTLDGCSKLEKFPDIVGNMNCLTVLCLDETGITKLCSSIHHLIGLGLLSMNSCKNLESIPSSIGCLKSLKKLDLSGCSELKYIPENLGKVESLEEFDVSGTSIRQLPASIFLLKNLKVLSSDGCERIAKLPSYSGL

FPrintScan: PR00364
IPR000767
689-705 DISEASERSIST
Disease resistance protein

GCLKSLKKLDLSGCSEL

HMMPfam: PF00560
IPR001611
693-713 LRR_1
Leucine-rich repeat

SLKKLDLSGCSELKYIPENLG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox