PRGDB00047380 (TIR-NBS type disease resistance protein)

From PRG Wiki
Jump to: navigation, search
TIR-NBS type disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 105923040 (DQ513238)
Gene Class TNL
Domain Type LRR, NBS, TIR, Others
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa clone 65744 TIR-NBS type disease resistance protein mRNA, complete cds.

DNA Sequence

ATGTTACAACAAGAGAAATCACAGGAGAAGGAAAAACAGTCTGGTGATGCACAACAGGTGGAGTTGGAGACTTCAGTCATTCCTATAAAGACTGTTCAGACAATCCCTACTGAAGGAGATTCAGATGAAAGTTCAGATGAAGAGGATGCAACAACTCCAGCAACCACTCAACAAGAATCCATTGCAACGAGTAAACCAAAAAGGGTCATCAAGAAACCTGCTCGGTATTGTAACATGGTGGCTTACGCACTTCCGGTGATTGATGATGGAATCCCCTACACCTACAAAGAAGCAGTACAGAGTGTAGAAAGAAAGAAGACAATTGGTTGCAAGTGGGTATATGCCAAGAAGGAAGGTAATCCTGGAAAAGACAACATCCGATTCAAAGCGAGATTGGTAGCAAAAGGCTATGCTCAGAAGGAGGGGATAGATTATAATGAGGTATTCTCTCCAGTTGTTAAGCATTCATCAATCCGTATTCTGTTAGCCTTGGTTGCACAGTTTGATTTGGAGTTAGCCCAACTTGATGTGAAAACTGCCTTCCTACATGGAGATTTGGAAGAGGAAATTTACATGTCTCAGCCAGATGGTTTCAAAAGCAAGGTGGAGATTGATAGACTGAAAGCTCAACTGAGAACTGAGTTTGAAATGAAGGACCTTGGAGAAGCTAAGAAGATTCTTGGCATAGAGATTCAGAGAGATAGAAGAAAAGGCACAGTCTGTTTGACACAGACCCAATACTTGAAGAAAATTCTACAGAGATTTGGGGTAGATGGTAAGACCAAGCCTGTAAGCACACCTTTAGCTCCTCATTTTAAGCTAAGTGCTTCAATGTCTCCACGCATAGAGGAAGAGCGCAAACATATGGCTCAAATTCCTTATGCAAATGCAGTTGGTGCATTAATATCGTTGAAAAGTCTTGTCTTTGCTAGACTTGAAATGGCTGCTGGGAAATATCAAGAATCCTACTCTTCTCGGTTTTCTAATTGTAAATATCAAGTGTTCTTGAGTTTTAGAGGTGAAGACACCCGCAGGAACTTTACCGATCACCTCTACAAGGCCCTGGTTGATGCAGGGATTCACACATTTAGAGATGATGATGAAATTCGGAGAGGAGAGAGTATAGATTTCGAGCTCCAGATGGCAATACAGCAATCAAAAATATCGATAATCGTGTTCTCCATAGACTATGCTTCGTCGAGATGGTGCCTCGATGAACTTGTAATGATCATGGAACGTAAGAGAAATGATGACTGCATAGTTTTGCCAGTATTCTATGATGTGGATCCATCCCAAGTCGGACGTCAAACAGGGAGCTTCGCTGCAACATTTGTGGAACATGAAAAGAGCTTCAACGAGGACATGGAGCGGGTGAATAGGTGGAGGATTGCTTTGAAGGAAGTTGCAGATTTAGCTGGAATGGTTTTAGGAGATGGGTACGAGGCACAGTTTGTCCAATCTATTGTGGAGAAGGTCTCAAAGAAATTGGATCAAAAAATGTTTCATTTACCCCTTCATTTCATTGGAAGAGATCCTCTAGTAAATTATATCAACTCATGGTTGCAAGAAGGGTCCCATGATGCTGCCATTGCTATACTCTATGGAATTGGTGGAGTTGGGAAGACAATCATAGCAAAGAGTGTTTTTAATCAGAATATTCATAAATTTGAAGGAAAGAGCTTCCTATCAAATTTTAGATCAAAGGATATAGTTTGCCTACAGAGGCAACTTCTTTCCGACATCCTAAAAAAGACTATTGATGAGATAAATGATGAAGATGAAGGAATTCTGAAGATTAAGGATGCATTATGTTGCAGAAAAACTCTTATTGTTCTAGATGATGTGGACAAAAGGGACCAATTTAATAAAATCATTGGCATGCAAAACTGGCTTTGTAAGGGAAGTAAAATCATTGTAACAACCAGAAATAAGGGTCTATTTTCAGCTAATGATATTGAGCGTGTCGAGTTCAAAGTTGAACCGCTAGATAATGAAAAATCACTTGAGCTTTTTAGTTGGAATGCCTTTGGACAAGCTGACCCTGTTGATGGTTTTGTAGAAGACTCTTGGAGAATAGTACATCATTGTAATGGACTTCCATTAGCTCTTCGAGTTATTGGCTCTTTATTGTCCGGGAAAGGAAGAGAGATATGGGAAAGCGCATTACAACAAATGGAAGTGATTCTCAATTTTGAAGTTCAAAAGGTTCTTCGAATAAGTTATGACTTTCTTGATGGTGATTATCCGAAAAACTTATTCCTTGATATCGCATGTTTCTTCAATGGAATGGATGTTGATGATGCAGTTAGGATATTGGATGGGCTCGATAAAGGTGCAAGATTTGGGATAGACAATCTCATCGATAGATGTCTTGTTGAAATCAACAATGATCAAAGGCTGTGGATGCATCAACTAGTAAGAGATATGGGAAGGGAAATTGCTCGTCAAGAATCAACCAAATGTCAAAGAATATGGCGTCACGAGGATGCTTTTACAGTTTTGAAAGGAACTACTGATGTTGAAAAATTGCGTGGCCTTACCCTTGATATGCATGCATTAATGGAAGATAACTTTGCAGAGGTTGTCTGTACTGATTCAATGGTTCGCCGCAAGCGCCGCAGGCTTAACTTCTTTCAACTATGGCTTTCTGACTTTTCCGATGGGGGAAAATTACAAACTGGCCAAACAAGTTTGTTTCCCATCCTTAGCACGGATGCTTTTAGAAAGATGCCAGATGTAAGATTTCTCCAACTAAATTACACGAAGTTCTATGGAAGTTTTGAGCACATCCCTAAGAATTTGATATGGTTATGTTGGCATGGATTCTCTTTGAGATCCATACCAAATCACGTATGTTTGGAGAAGCTGGTGGTTCTTGATCTATCTAAAAGCTGTCTAGTTGATGCTTGGAAAGGCAAACCGTTTCTTCCAAAATTGAAAATTCTTGATCTCCGTCACTCTCTTAATCTCATTAGAACCCCAGACTTTTTGGGTCTCCCAGCACTTGAAAAGCTAATACTTGAAGACTGCATCCGTTTAGTTCAAATTCACGAATCTATTGGTGATTTACAAAGATTGTTGTTCTTAAATCTAAGAAACTGTACAAGTCTTGTGGAGCTTCCAGAAGAAATGGGTAGATTGAATTCACTTGAAGAGCTGGTTGTAGATGGTTGCTCAAATCTTGACGGCTTGAATATGGAGTTAGAGCTTCATCAGGGGCGCAACTTGCTTCAAAGTGATGGAATTGTTGCAAACATTGTTTTGGTGGTACAGATCGCATATAAAGATGGCAAATTCAAAGTTGTCGTATTTGTATATGATGAAGATGAGATGTTAAGGGGGTTTTGTGCGGAGGGAGAAGAGGATAAATGGCTAATTCAGAATGAGTTCGTAGATAACTTTTCATTCAAAATATCATCATCTCCTGCGCACCGGATATGTGGCTTTAATCTGTTCACAAGCTTTAGTGTGATGTCAGGGTACAGTTTCTCTGAAAAACTTGGTATTGAAATCAGAAACAATACCAGTGGCCAGTCCTGGCGTCGTCAAGCCCATGTCTTAGATATACGTTTCAGGGATGAGGTTCGTGGAATCCAATCGCTAAGCCACTGGAAATTAGGGGGCGATGATCCTACATTTGATAATGGTGATGACGTGACAATTTCAATGGTTGTTGTCACGTCAGCTATTCAAATAAGGACCGTTGGTGTACAATGGTTGCATGAAGAGGAAGGAAAGGATGATGATATCCAATCAAAGGATGAAGTTATCAATGCCCACAATAGTGGCGATGATGATGATGATGATGCAGCACACGTAGCCAAAGTAGAAATAGCTTCTCGTATTTTTAGAAATTATTACTGTGCTTTCCGTCTAGACTTTTATGGGGGCTATTTAGCTTGGTGGTTTTTTTGCAAAGAAAGGTCTTGA


Protein sequences

Name Description Sequence
TIR-NBS type disease resistance protein TIR-NBS type disease resistance protein [Populus trichocarpa].

MLQQEKSQEKEKQSGDAQQVELETSVIPIKTVQTIPTEGDSDESSDEEDATTPATTQQESIATSKPKRVIKKPARYCNMVAYALPVIDDGIPYTYKEAVQSVERKKTIGCKWVYAKKEGNPGKDNIRFKARLVAKGYAQKEGIDYNEVFSPVVKHSSIRILLALVAQFDLELAQLDVKTAFLHGDLEEEIYMSQPDGFKSKVEIDRLKAQLRTEFEMKDLGEAKKILGIEIQRDRRKGTVCLTQTQYLKKILQRFGVDGKTKPVSTPLAPHFKLSASMSPRIEEERKHMAQIPYANAVGALISLKSLVFARLEMAAGKYQESYSSRFSNCKYQVFLSFRGEDTRRNFTDHLYKALVDAGIHTFRDDDEIRRGESIDFELQMAIQQSKISIIVFSIDYASSRWCLDELVMIMERKRNDDCIVLPVFYDVDPSQVGRQTGSFAATFVEHEKSFNEDMERVNRWRIALKEVADLAGMVLGDGYEAQFVQSIVEKVSKKLDQKMFHLPLHFIGRDPLVNYINSWLQEGSHDAAIAILYGIGGVGKTIIAKSVFNQNIHKFEGKSFLSNFRSKDIVCLQRQLLSDILKKTIDEINDEDEGILKIKDALCCRKTLIVLDDVDKRDQFNKIIGMQNWLCKGSKIIVTTRNKGLFSANDIERVEFKVEPLDNEKSLELFSWNAFGQADPVDGFVEDSWRIVHHCNGLPLALRVIGSLLSGKGREIWESALQQMEVILNFEVQKVLRISYDFLDGDYPKNLFLDIACFFNGMDVDDAVRILDGLDKGARFGIDNLIDRCLVEINNDQRLWMHQLVRDMGREIARQESTKCQRIWRHEDAFTVLKGTTDVEKLRGLTLDMHALMEDNFAEVVCTDSMVRRKRRRLNFFQLWLSDFSDGGKLQTGQTSLFPILSTDAFRKMPDVRFLQLNYTKFYGSFEHIPKNLIWLCWHGFSLRSIPNHVCLEKLVVLDLSKSCLVDAWKGKPFLPKLKILDLRHSLNLIRTPDFLGLPALEKLILEDCIRLVQIHESIGDLQRLLFLNLRNCTSLVELPEEMGRLNSLEELVVDGCSNLDGLNMELELHQGRNLLQSDGIVANIVLVVQIAYKDGKFKVVVFVYDEDEMLRGFCAEGEEDKWLIQNEFVDNFSFKISSSPAHRICGFNLFTSFSVMSGYSFSEKLGIEIRNNTSGQSWRRQAHVLDIRFRDEVRGIQSLSHWKLGGDDPTFDNGDDVTISMVVVTSAIQIRTVGVQWLHEEEGKDDDIQSKDEVINAHNSGDDDDDDAAHVAKVEIASRIFRNYYCAFRLDFYGGYLAWWFFCKERS

Domains

Domain Start-End Description Sequence

HMMPfam: PF07727
IPR013103
98-201 RVT_2
Reverse transcriptase, RNA-dependent DNA polymeras

AVQSVERKKTIGCKWVYAKKEGNPGKDNIRFKARLVAKGYAQKEGIDYNEVFSPVVKHSSIRILLALVAQFDLELAQLDVKTAFLHGDLEEEIYMSQPDGFKSK

superfamily: SSF52200
IPR000157
320-474 TIR
Toll/interleukin-1 receptor homology (TIR) domain

QESYSSRFSNCKYQVFLSFRGEDTRRNFTDHLYKALVDAGIHTFRDDDEIRRGESIDFELQMAIQQSKISIIVFSIDYASSRWCLDELVMIMERKRNDDCIVLPVFYDVDPSQVGRQTGSFAATFVEHEKSFNEDMERVNRWRIALKEVADLAGM

Gene3D: G3DSA:3.40.50.10140
329-461 G3DSA:3.40.50.10140

NCKYQVFLSFRGEDTRRNFTDHLYKALVDAGIHTFRDDDEIRRGESIDFELQMAIQQSKISIIVFSIDYASSRWCLDELVMIMERKRNDDCIVLPVFYDVDPSQVGRQTGSFAATFVEHEKSFNEDMERVNRW

ProfileScan: PS50104
IPR000157
330-471 TIR
Toll/interleukin-1 receptor homology (TIR) domain

CKYQVFLSFRGEDTRRNFTDHLYKALVDAGIHTFRDDDEIRRGESIDFELQMAIQQSKISIIVFSIDYASSRWCLDELVMIMERKRNDDCIVLPVFYDVDPSQVGRQTGSFAATFVEHEKSFNEDMERVNRWRIALKEVADL

HMMSmart: SM00255
IPR000157
331-471 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KYQVFLSFRGEDTRRNFTDHLYKALVDAGIHTFRDDDEIRRGESIDFELQMAIQQSKISIIVFSIDYASSRWCLDELVMIMERKRNDDCIVLPVFYDVDPSQVGRQTGSFAATFVEHEKSFNEDMERVNRWRIALKEVADL

HMMPfam: PF01582
IPR000157
334-466 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGEDTRRNFTDHLYKALVDAGIHTFRDDDEIRRGESIDFELQMAIQQSKISIIVFSIDYASSRWCLDELVMIMERKRNDDCIVLPVFYDVDPSQVGRQTGSFAATFVEHEKSFNEDMERVNRWRIALK

HMMPanther: PTHR11017:SF20
358-1061 PTHR11017:SF20,SUBFAMILY NOT NAMED

AGIHTFRDDDEIRRGESIDFELQMAIQQSKISIIVFSIDYASSRWCLDELVMIMERKRNDDCIVLPVFYDVDPSQVGRQTGSFAATFVEHEKSFNEDMERVNRWRIALKEVADLAGMVLGDGYEAQFVQSIVEKVSKKLDQKMFHLPLHFIGRDPLVNYINSWLQEGSHDAAIAILYGIGGVGKTIIAKSVFNQNIHKFEGKSFLSNFRSKDIVCLQRQLLSDILKKTIDEINDEDEGILKIKDALCCRKTLIVLDDVDKRDQFNKIIGMQNWLCKGSKIIVTTRNKGLFSANDIERVEFKVEPLDNEKSLELFSWNAFGQADPVDGFVEDSWRIVHHCNGLPLALRVIGSLLSGKGREIWESALQQMEVILNFEVQKVLRISYDFLDGDYPKNLFLDIACFFNGMDVDDAVRILDGLDKGARFGIDNLIDRCLVEINNDQRLWMHQLVRDMGREIARQESTKCQRIWRHEDAFTVLKGTTDVEKLRGLTLDMHALMEDNFAEVVCTDSMVRRKRRRLNFFQLWLSDFSDGGKLQTGQTSLFPILSTDAFRKMPDVRFLQLNYTKFYGSFEHIPKNLIWLCWHGFSLRSIPNHVCLEKLVVLDLSKSCLVDAWKGKPFLPKLKILDLRHSLNLIRTPDFLGLPALEKLILEDCIRLVQIHESIGDLQRLLFLNLRNCTSLVELPEEMGRLNSLEELVVDGCSNL

HMMPanther: PTHR11017
358-1061 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AGIHTFRDDDEIRRGESIDFELQMAIQQSKISIIVFSIDYASSRWCLDELVMIMERKRNDDCIVLPVFYDVDPSQVGRQTGSFAATFVEHEKSFNEDMERVNRWRIALKEVADLAGMVLGDGYEAQFVQSIVEKVSKKLDQKMFHLPLHFIGRDPLVNYINSWLQEGSHDAAIAILYGIGGVGKTIIAKSVFNQNIHKFEGKSFLSNFRSKDIVCLQRQLLSDILKKTIDEINDEDEGILKIKDALCCRKTLIVLDDVDKRDQFNKIIGMQNWLCKGSKIIVTTRNKGLFSANDIERVEFKVEPLDNEKSLELFSWNAFGQADPVDGFVEDSWRIVHHCNGLPLALRVIGSLLSGKGREIWESALQQMEVILNFEVQKVLRISYDFLDGDYPKNLFLDIACFFNGMDVDDAVRILDGLDKGARFGIDNLIDRCLVEINNDQRLWMHQLVRDMGREIARQESTKCQRIWRHEDAFTVLKGTTDVEKLRGLTLDMHALMEDNFAEVVCTDSMVRRKRRRLNFFQLWLSDFSDGGKLQTGQTSLFPILSTDAFRKMPDVRFLQLNYTKFYGSFEHIPKNLIWLCWHGFSLRSIPNHVCLEKLVVLDLSKSCLVDAWKGKPFLPKLKILDLRHSLNLIRTPDFLGLPALEKLILEDCIRLVQIHESIGDLQRLLFLNLRNCTSLVELPEEMGRLNSLEELVVDGCSNL

superfamily: SSF52540
484-849 SSF52540

FVQSIVEKVSKKLDQKMFHLPLHFIGRDPLVNYINSWLQEGSHDAAIAILYGIGGVGKTIIAKSVFNQNIHKFEGKSFLSNFRSKDIVCLQRQLLSDILKKTIDEINDEDEGILKIKDALCCRKTLIVLDDVDKRDQFNKIIGMQNWLCKGSKIIVTTRNKGLFSANDIERVEFKVEPLDNEKSLELFSWNAFGQADPVDGFVEDSWRIVHHCNGLPLALRVIGSLLSGKGREIWESALQQMEVILNFEVQKVLRISYDFLDGDYPKNLFLDIACFFNGMDVDDAVRILDGLDKGARFGIDNLIDRCLVEINNDQRLWMHQLVRDMGREIARQESTKCQRIWRHEDAFTVLKGTTDVEKLRGLTLD

Gene3D: G3DSA:3.40.50.300
506-656 G3DSA:3.40.50.300

HFIGRDPLVNYINSWLQEGSHDAAIAILYGIGGVGKTIIAKSVFNQNIHKFEGKSFLSNFRSKDIVCLQRQLLSDILKKTIDEINDEDEGILKIKDALCCRKTLIVLDDVDKRDQFNKIIGMQNWLCKGSKIIVTTRNKGLFSANDIERVE

HMMPfam: PF00931
IPR002182
513-766 NB-ARC,NBS
NB-ARC

LVNYINSWLQEGSHDAAIAILYGIGGVGKTIIAKSVFNQNIHKFEGKSFLSNFRSKDIVCLQRQLLSDILKKTIDEINDEDEGILKIKDALCCRKTLIVLDDVDKRDQFNKIIGMQNWLCKGSKIIVTTRNKGLFSANDIERVEFKVEPLDNEKSLELFSWNAFGQADPVDGFVEDSWRIVHHCNGLPLALRVIGSLLSGKGREIWESALQQMEVILNFEVQKVLRISYDFLDGDYPKNLFLDIACFFNGMDVD

FPrintScan: PR00364
IPR000767
530-545 DISEASERSIST
Disease resistance protein

IAILYGIGGVGKTIIA

FPrintScan: PR00364
IPR000767
602-616 DISEASERSIST
Disease resistance protein

ALCCRKTLIVLDDVD

FPrintScan: PR00364
IPR000767
696-710 DISEASERSIST
Disease resistance protein

CNGLPLALRVIGSLL

superfamily: SSF52058
785-1076 SSF52058,LRR

NLIDRCLVEINNDQRLWMHQLVRDMGREIARQESTKCQRIWRHEDAFTVLKGTTDVEKLRGLTLDMHALMEDNFAEVVCTDSMVRRKRRRLNFFQLWLSDFSDGGKLQTGQTSLFPILSTDAFRKMPDVRFLQLNYTKFYGSFEHIPKNLIWLCWHGFSLRSIPNHVCLEKLVVLDLSKSCLVDAWKGKPFLPKLKILDLRHSLNLIRTPDFLGLPALEKLILEDCIRLVQIHESIGDLQRLLFLNLRNCTSLVELPEEMGRLNSLEELVVDGCSNLDGLNMELELHQGRNL

Gene3D: G3DSA:3.80.10.10
901-1067 G3DSA:3.80.10.10

ILSTDAFRKMPDVRFLQLNYTKFYGSFEHIPKNLIWLCWHGFSLRSIPNHVCLEKLVVLDLSKSCLVDAWKGKPFLPKLKILDLRHSLNLIRTPDFLGLPALEKLILEDCIRLVQIHESIGDLQRLLFLNLRNCTSLVELPEEMGRLNSLEELVVDGCSNLDGLNME

FPrintScan: PR00364
IPR000767
974-990 DISEASERSIST
Disease resistance protein

PFLPKLKILDLRHSLNL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox