PRGDB00047383 (TIR-NBS type disease resistance protein)

From PRG Wiki
Jump to: navigation, search
TIR-NBS type disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 105922991 (DQ513235)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa clone 124140 TIR-NBS type disease resistance protein mRNA, complete cds.

DNA Sequence

ATGGCTGGTGGGAAATATCAAGAATCCTCCTCTTCACGGTTTTCTAATTGTAAACATCAAGTGTTCTTGAGTTTTAGAGGTGAAGACACCCGCAGGAAATTTACCGATCACCTCTACACGGCCCTAGTCCAAGCTGGGATTCACACATTTAGAGATGATGATGAGATTCAGAGAGGACATAATATAGAGTTGGAGATCCAGAAAGCAATACAACAATCAAAAATATCGATAATCGTGTTCTCCATAGACTATGCTCGTTCGAGATGGTGCCTCGATGAACTTGTTATGATCATGGAACGTAAGAGGACTACTAACTCCATAGTTTTGCCGGTATTCTATGATGTGGATCCATCCCAAGTTAGAAATCAAACTGGGAGCTTCGCTGCAGCATTTGTGGAACACGAAAAGCGCTTCAAGGAGGAGATGGAGCGGGTGAATGGATGGAGGATTGCTTTGAAGGAAGTTGCAGATTTGGGAGGAATGGTTTTAGGAGATGGGTCCCATAGTGCTGCCATTGCTTTACTCTATGGAATTGGTGGAGTTGGAAAGACTGCCATAGCCAAGAATGTTTATAACCAGAACTTTTATAAATTTGAAGGAAAGAGCTTTCTTTCAAATTTTAGAGAAAGGTCAAAGGAATTCAAGGGTTTAGTTTGCCTACAGAGGCAACTTCTTTCCGACATCCTAAAAAAGAGTGTTGATGAGATAAATGATGTTGATGAAGGAATTTTGAAGATTAAGGATGTAATATGTTGTCGAAGAACTCTTATTGTTCTAGATGACGTGGAGGAAAGGGACCAATTCAATGCAATCGTTGGCATGCAAAATTGGCTTTGTAAAGGAAGTAAAATCATTGTAACGACCAGAAATAAGGGTCTGCTTTCAGCTAATGATAAGTGGGTTAAGTGCAAAGTTGAACCTCTAGATAACGGAAAATCACTTGAGCTTTTCAGTTGGCATGCCTTTGGACAAGCTTACCCTGTTGAAGGTTTTGTAGAGGACTCTTGGAAAATAGTGAATCATTGTAATGGACTTCCATTGGCCCTTCGTGTTATTGGTTCTTCATTATCTGGTAAAAGTCGAGAAGTATGGGAAAGTGCATTGCATGAAATGGAAGTGATTCCAAATTGTGAAGTTCAAAAGATTCTTCGAATAAGTTACGACTCTCTCGATGATGAATACCAGAAGAACTTATTCCTTGATATTGCTTGTTTCTTCAATGGAATGGATTACAATTATGCTGTTAGGATACTAGATGGGCTCGGTATAGGTGCAAGATTCAGGATTGACAATCTCATCGATAGATGTCTTGTAGAAATTGTTGAAATCAACAGTGATAAAAGGTTGTGGATGCATCAACTCGTAAGAGATATGGGAAGGGAAATTTCTCGTCAAGAATCACCCCAGTGTCAAAGAATATGGCATCACATGGAAGCTTTTACAGTTTTGAAAGAAGCAAGTGATGCTGAAAAATTGCGTGGCCTTACCATTGATATGCATGCATTAATGGAAGATAATTGTACCAAAGCTATCTGTGGTGATTCAATGGTTCGCCACAAGCATAACTTCTTTCAACATTATCGTCTTCCTACGTTCCCCTCTCGAGAATGGCTTTCTGACCTTTTCTTCGGGGAACAAGTACAAAGTGGTCAAGCAAGTTTGTTACCCGTCCTCAGCACGGATGCTTTGAGAAAGATGCAAAATGTAAAATTTCTCCAACTAAATTACCTGAAGTTCCATGGAAGTTATGAACACTTCCCTAAGAATTTGGTAACAGTTTTTAAGGGCGTATTCAACGTTGTCGTAGCTGATGAAGATGGGATGTTTAAGTTTTATGAGGAGGAAGAAGAGGAGTGGATAATTCAGAAAGAGTTTGTGGGCTGCCTGTCATTTCAAATAGCCTCACCTGCTGCGCACCGGATATGTGGTTTTAATCTATTCACAAGTGGCTACAAGCACGGGAATGCTGTACTCCAATCGCTAAGCCACTGGAAATTAGGGGGCGATGATCCTACATTTGATAATGGTGATGACGTGAGTATTTCAGTGCTTCCACTTGATCCAACTATTCAAATAATGATGGTTGGTGTCCTATGGTTGCATGAAGAGGAAGGAAATGGTGATGATGATGATATCCAATCAAAGAATAAAGTTATCACATCCCAAAGGAAGTTATCACAACCCACAACAGTAGCTGATGATGATGATGATGATGATGTACATCTAGCCAATGTAGAAACAGCTTGTCATATTTTTAGGAATTATTCCTGTGCTGCGCGTTATAATCCTGGCAACTTGGAAGTATGTTCGTGGTTATTTGAAAAGAAAGTTTGGGTGTTAGATTGGAAGGCAGCAACACACCAGCTTTTTGGATATATAGTCGCCTTGATGCCCTACTCTCGATTCAGTTCATTTGGCTGA


Protein sequences

Name Description Sequence
TIR-NBS type disease resistance protein TIR-NBS type disease resistance protein [Populus trichocarpa].

MAGGKYQESSSSRFSNCKHQVFLSFRGEDTRRKFTDHLYTALVQAGIHTFRDDDEIQRGHNIELEIQKAIQQSKISIIVFSIDYARSRWCLDELVMIMERKRTTNSIVLPVFYDVDPSQVRNQTGSFAAAFVEHEKRFKEEMERVNGWRIALKEVADLGGMVLGDGSHSAAIALLYGIGGVGKTAIAKNVYNQNFYKFEGKSFLSNFRERSKEFKGLVCLQRQLLSDILKKSVDEINDVDEGILKIKDVICCRRTLIVLDDVEERDQFNAIVGMQNWLCKGSKIIVTTRNKGLLSANDKWVKCKVEPLDNGKSLELFSWHAFGQAYPVEGFVEDSWKIVNHCNGLPLALRVIGSSLSGKSREVWESALHEMEVIPNCEVQKILRISYDSLDDEYQKNLFLDIACFFNGMDYNYAVRILDGLGIGARFRIDNLIDRCLVEIVEINSDKRLWMHQLVRDMGREISRQESPQCQRIWHHMEAFTVLKEASDAEKLRGLTIDMHALMEDNCTKAICGDSMVRHKHNFFQHYRLPTFPSREWLSDLFFGEQVQSGQASLLPVLSTDALRKMQNVKFLQLNYLKFHGSYEHFPKNLVTVFKGVFNVVVADEDGMFKFYEEEEEEWIIQKEFVGCLSFQIASPAAHRICGFNLFTSGYKHGNAVLQSLSHWKLGGDDPTFDNGDDVSISVLPLDPTIQIMMVGVLWLHEEEGNGDDDDIQSKNKVITSQRKLSQPTTVADDDDDDDVHLANVETACHIFRNYSCAARYNPGNLEVCSWLFEKKVWVLDWKAATHQLFGYIVALMPYSRFSSFG

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF20
1-505 PTHR11017:SF20,SUBFAMILY NOT NAMED

MAGGKYQESSSSRFSNCKHQVFLSFRGEDTRRKFTDHLYTALVQAGIHTFRDDDEIQRGHNIELEIQKAIQQSKISIIVFSIDYARSRWCLDELVMIMERKRTTNSIVLPVFYDVDPSQVRNQTGSFAAAFVEHEKRFKEEMERVNGWRIALKEVADLGGMVLGDGSHSAAIALLYGIGGVGKTAIAKNVYNQNFYKFEGKSFLSNFRERSKEFKGLVCLQRQLLSDILKKSVDEINDVDEGILKIKDVICCRRTLIVLDDVEERDQFNAIVGMQNWLCKGSKIIVTTRNKGLLSANDKWVKCKVEPLDNGKSLELFSWHAFGQAYPVEGFVEDSWKIVNHCNGLPLALRVIGSSLSGKSREVWESALHEMEVIPNCEVQKILRISYDSLDDEYQKNLFLDIACFFNGMDYNYAVRILDGLGIGARFRIDNLIDRCLVEIVEINSDKRLWMHQLVRDMGREISRQESPQCQRIWHHMEAFTVLKEASDAEKLRGLTIDMHALMED

HMMPanther: PTHR11017
1-505 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MAGGKYQESSSSRFSNCKHQVFLSFRGEDTRRKFTDHLYTALVQAGIHTFRDDDEIQRGHNIELEIQKAIQQSKISIIVFSIDYARSRWCLDELVMIMERKRTTNSIVLPVFYDVDPSQVRNQTGSFAAAFVEHEKRFKEEMERVNGWRIALKEVADLGGMVLGDGSHSAAIALLYGIGGVGKTAIAKNVYNQNFYKFEGKSFLSNFRERSKEFKGLVCLQRQLLSDILKKSVDEINDVDEGILKIKDVICCRRTLIVLDDVEERDQFNAIVGMQNWLCKGSKIIVTTRNKGLLSANDKWVKCKVEPLDNGKSLELFSWHAFGQAYPVEGFVEDSWKIVNHCNGLPLALRVIGSSLSGKSREVWESALHEMEVIPNCEVQKILRISYDSLDDEYQKNLFLDIACFFNGMDYNYAVRILDGLGIGARFRIDNLIDRCLVEIVEINSDKRLWMHQLVRDMGREISRQESPQCQRIWHHMEAFTVLKEASDAEKLRGLTIDMHALMED

superfamily: SSF52200
IPR000157
7-161 TIR
Toll/interleukin-1 receptor homology (TIR) domain

QESSSSRFSNCKHQVFLSFRGEDTRRKFTDHLYTALVQAGIHTFRDDDEIQRGHNIELEIQKAIQQSKISIIVFSIDYARSRWCLDELVMIMERKRTTNSIVLPVFYDVDPSQVRNQTGSFAAAFVEHEKRFKEEMERVNGWRIALKEVADLGGM

Gene3D: G3DSA:3.40.50.10140
16-146 G3DSA:3.40.50.10140

NCKHQVFLSFRGEDTRRKFTDHLYTALVQAGIHTFRDDDEIQRGHNIELEIQKAIQQSKISIIVFSIDYARSRWCLDELVMIMERKRTTNSIVLPVFYDVDPSQVRNQTGSFAAAFVEHEKRFKEEMERVN

ProfileScan: PS50104
IPR000157
17-158 TIR
Toll/interleukin-1 receptor homology (TIR) domain

CKHQVFLSFRGEDTRRKFTDHLYTALVQAGIHTFRDDDEIQRGHNIELEIQKAIQQSKISIIVFSIDYARSRWCLDELVMIMERKRTTNSIVLPVFYDVDPSQVRNQTGSFAAAFVEHEKRFKEEMERVNGWRIALKEVADL

HMMSmart: SM00255
IPR000157
18-158 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KHQVFLSFRGEDTRRKFTDHLYTALVQAGIHTFRDDDEIQRGHNIELEIQKAIQQSKISIIVFSIDYARSRWCLDELVMIMERKRTTNSIVLPVFYDVDPSQVRNQTGSFAAAFVEHEKRFKEEMERVNGWRIALKEVADL

HMMPfam: PF01582
IPR000157
21-153 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGEDTRRKFTDHLYTALVQAGIHTFRDDDEIQRGHNIELEIQKAIQQSKISIIVFSIDYARSRWCLDELVMIMERKRTTNSIVLPVFYDVDPSQVRNQTGSFAAAFVEHEKRFKEEMERVNGWRIALK

superfamily: SSF52540
151-498 SSF52540

ALKEVADLGGMVLGDGSHSAAIALLYGIGGVGKTAIAKNVYNQNFYKFEGKSFLSNFRERSKEFKGLVCLQRQLLSDILKKSVDEINDVDEGILKIKDVICCRRTLIVLDDVEERDQFNAIVGMQNWLCKGSKIIVTTRNKGLLSANDKWVKCKVEPLDNGKSLELFSWHAFGQAYPVEGFVEDSWKIVNHCNGLPLALRVIGSSLSGKSREVWESALHEMEVIPNCEVQKILRISYDSLDDEYQKNLFLDIACFFNGMDYNYAVRILDGLGIGARFRIDNLIDRCLVEIVEINSDKRLWMHQLVRDMGREISRQESPQCQRIWHHMEAFTVLKEASDAEKLRGLTID

HMMPfam: PF00931
IPR002182
170-412 NB-ARC,NBS
NB-ARC

AAIALLYGIGGVGKTAIAKNVYNQNFYKFEGKSFLSNFRERSKEFKGLVCLQRQLLSDILKKSVDEINDVDEGILKIKDVICCRRTLIVLDDVEERDQFNAIVGMQNWLCKGSKIIVTTRNKGLLSANDKWVKCKVEPLDNGKSLELFSWHAFGQAYPVEGFVEDSWKIVNHCNGLPLALRVIGSSLSGKSREVWESALHEMEVIPNCEVQKILRISYDSLDDEYQKNLFLDIACFFNGMDYN

Gene3D: G3DSA:3.40.50.300
172-295 G3DSA:3.40.50.300

IALLYGIGGVGKTAIAKNVYNQNFYKFEGKSFLSNFRERSKEFKGLVCLQRQLLSDILKKSVDEINDVDEGILKIKDVICCRRTLIVLDDVEERDQFNAIVGMQNWLCKGSKIIVTTRNKGLLS

FPrintScan: PR00364
IPR000767
172-187 DISEASERSIST
Disease resistance protein

IALLYGIGGVGKTAIA

FPrintScan: PR00364
IPR000767
249-263 DISEASERSIST
Disease resistance protein

VICCRRTLIVLDDVE

FPrintScan: PR00364
IPR000767
342-356 DISEASERSIST
Disease resistance protein

CNGLPLALRVIGSSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox