PRGDB00047394 (TIR-NBS-LRR-TIR type disease resistance protein)

From PRG Wiki
Jump to: navigation, search
TIR-NBS-LRR-TIR type disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 105922809 (DQ513224)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, LRR, TIR, Others
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa clone 528929 TIR-NBS-LRR-TIR type disease resistance protein mRNA, complete cds.

DNA Sequence

ATGCTTGACTTGAAAATTCATTACAAAACACGAATCAACTCAATTGTGAGGTGCGTGGCCCCACCCCTGCTCTTGACAGGAAGGTGCCTCTGCTGCCCAATGCGCGTTCGATATCCCTTTCATTTCTTTCTCTACTTTTTCTCCACCGAAAGTCCATCTTCTTTACAGTGTAAGATCCGTAAGAAAATCATTGGAAACTTACCAATACGAGTTCTTGACCTAAAGGAACCGGAAAAAATTCGAAGTCATTGGAATAAAAAGAAAGTAAAGGGCTTTGGAAGGATTTTCATGGCTTCCACCAGCGTGCAAGGAATAACCTCATCTTCATCTTCTCCTCCACTATATAAGTATGATGTGTTCCTTAGTTTTAGAGGCAAAGACACCCGGAACAACTTTACTAGTCATCTACAAACTAATCTGGCACAGAGAGGCATCGATGCATACATGGATGATAGGGAGCTCGAGAGAGGAAAGACCATTGAACCTGCTCTCTGGAAGGCCATCGAAGAATCAAGGTTTTCTGTCATTATATTTTCAAGAGATTACGCTTCTTCACCATGGTGCTTGGATGAACTTGTCAAGATTGTTCAGGGCATGAAAGAGATGGGGCACACTGTTCTGCCAGTTTTTTATGATGTGGATCCCTCAGAGACATATGAGAAAGCCTTCGTTGAGCATGAACAAAATTTCAAGGAAAATCTGGAGAAGGTCCAGATCTGGAAAGATTGTCTCTCTACGGTGACCAATCTATCAGGCTGGGACATACGGAATAGGAATGAGTCGGAATCAATTAAAATAATTGCTGAATACATATCGTACAAACTAAGCGTCACTCTGCCAACAATTAGCAAAAAATTAGTTGGAATAGATTCTCGTGTAGAGGTATTAAATGGCTATATAGGTGAAGAAGTTGGCGAAGCAATCTTCATAGGGATTTGTGGAATGGGTGGCATAGGTAAGACGACTGTTTCAAGGGTACTATATGATAGGATTCGTTGGCAATTTGAAGGCAGCTGCTTCTTAGCAAATGTCAGAGAAGTTTTTGCTGAGAAAGATGGACCACGCCGTTTACAGGAACAACTTCTTTCTGAAATCTTAATGGAACGTGCTTCTGTATGGGATTCTTCTAGAGGGATTGAGATGATAAAGCGGAGGTTAAGACTTAAAAAGATTCTTCTTATCCTTGATGATGTAGATGACAAAAAACAACTAGAATTCTTGGCTGCGGAGCCTGGATGGTTTGGTCCAAGGAGCAGAATAATCATAACAAGCAGAGATAAAAATGTGTTTACTGGAAATGATGATACTAAAATTTATGAGGCTGAGAAATTGAATGATGATGATGCTCTTATGTTATTTAGCCAGAAAGCTTTCAAAAATGACCAACCTGCTGAAGATTTCGTGGAACTATCCAAGCAAGTTGTGGGTTATGCTAATGGCCTTCCACTGGCTCTTGAAGTTATAGGTTCGTTTTTGTATGGAAGAAGTATCCCTGAATGGAGAGGTGCAATTAATAGAATGCATGAGATTCCTGACTGCAAAATCATGGATGTGCTTCGCATTAGTTTTGATGGTCTCCATGAATCAGATCAGAAAATATTTTTAGACATTGCATGTTTCCTGAAGGGGTTTAAAAAAGATCGAATAACAAGGATACTTGACAGCTGTGGATTCAATGCAGGTATTGGAATACCAGTTCTTATTGAGAGATCTCTCATAAGTGTCTATGGGGATCAAGTCTGGATGCATAATTTATTACAGATAATGGGTAAGGAAATTGTTCGTTGTGAAGACCCTAAAGAGCCTGGAAAGCGCAGTAGATTGTGGACATACGAGGATGTCAGCCTTGCACTGATGGACAACACAGGAAAAGAAAAAATAGAAGCCATTTTCTTGGACATGCCTGGAATAAAAGAGGCACAATGGAACATGAAAGCCTTCTCTAAAATGAGCAGACTAAGATTGCTCAAAATCGACAACGTGCAGCTTTCTGAAGGACCTGAAGATCTTTCAAAGGAGTTACGATTTCTTGAATGGCATTCTTACCCTTCAAAATCATTGCCAGCTGGTTTACAGGTGGATGGGCTAGTTGAACTTCACATGGCTAACAGTAGTATTGAGCAATTATGGTATGGGTGTAAGAGTGCTGTTAATTTGAAAGTCATCAATCTCAGCAACTCACTAAACCTATCCAAGACTCCAGATCTTACTGGAATTCCAAATCTCTCGAGTCTGATTCTTGAAGGTTGTACAAGTTTGTCTGAGGTCCATCCATCACTTGGACGTCACAAGAATCTTCAATATGTGAATCTTGTGAATTGCAAAAGTTTTAGGATTCTCCCAAGCAACCTTGAAATGGAATCGCTTAAAGTTTTCACTCTTGATGGCTGCACAAAACTTGAGAAGTTTCCAGATATAGTGGGAAACATGAACTGTTTGATGGAGCTTTGTTTGGACGGGACTGGTATTGCTGAACTATCTTCATCAATTCATCATTTGATTGGCTTAGAAGTATTGAGCATGAACAACTGCAAGAACCTTGAAAGCATTCCGAGTAGCATAGGTTGCTTGAAATCCCTTAAAAAACTCGATCTGTCTGGCTGCTCTGAACTTAAAAATATACCAGAGAATTTGGGGAAAGTTGAAAGTTTGGAGGAGTTTGATGGTTTGTCTAATCCAAGACCTGGATTTGGTATCGCTTTTCCAGGAAATGAAATTCCAGGCTGGTTTAACCATCGAAAGCTTAAAGAATGGCAGCATGGATCCTTTAGCAACATTGAGTTGTCATTTCATTCTTTCCAGCCAGGAGTAAAGGTGAAGAATTGTGGTGTCTGTTTGTTATATTATTCATCATCTAAATCTTCTGCACGTTTTATTGTTGCAAGCAAAGAAGCATCATCCTCTTCATTTACATCTTCTTTATCGGTTTCTTCATCTTACCGTCAATGGGTGCAAGATTTTTTCCTTAGCTTCAGAGGCGCAGACACCAGCAATGATTTCATCCATTTAAATACAGCTCTAGCTCTGAGAGTCATTATCCCAGACGACAAGGAACTAGAGAAAGTAATGGCAATTAGATCAAGACTCTTTGAGGCCATTGAAGAATCAGGGCTGTCAATTATTATATTTGCAAGAGATTGTGCTTCTTTACCTTGGTGCTTTGACGAGCTTGTCAAGATTGTCGGATTCATGGATGAGATGAGATCGGACACTGTTTTTCCAGTTTCTTATGATGTCAAACAATCAAAGATAGATGATCAAACAGAGAGTTACACAATTGTCTTTGACAAGGATGAAGAAGATTTCAGGGAAAACGAGGAGAAGGTACAAAGGTGGACGAATATTCTCACGGAAGTTTTGTTTTCATCTGGACCAAGAAGGTTACACCTGACTGATGCGGAGCTTATGCTTTACTTGAAGAGGAAGATATGTGAGAATAGTTTTAAGTTTGATACTATTCCCGATGTTGATGTTTACAAGTGGGATCCTGAGGAGTTACCTGAGCTATCCCCATTGGAGAATCGGCAATGGTACTTCTTCGGTCCAAGAGGCCGTGCACCAAGAGGAGAGCGAACTGATTGGGAGATGCAAGAGTATACTTTGAATGAAAAAGAACTCAAGGGATGCACAAATGTGCAGGATTGTTATGCGCTTTACAAGCTTTATAAAAATAAAAAGAGAGCTTTAACTTCAACCAGCCAGCAACCTCAAAATTGCAATCACATCAGGCGCATGGCGTTGCATCCGCATTCACCCCCTGACTATGAACTTGATTTCCAGGAAATTCATCTCTTTGGTCCACAGCCTATTTTCTCCGAGACCATGCAACCTATTGAAAACTTGCAGTTTGGTGGTGGCGGATTCAGTGAGATGGACCGATGGTATGAGACCATGTTTCTGCGTGACAATATAGAGCCAGCTGATCAGGAAAGATGTCTTCTTGGAAAAGTCAAAAAAGGATCCTATTACTCTGCTATACGATTTGGACTGCTCCAATATGATATAGATTTTGCTGGACTGCGCTTTCTTGAGGCATCTCAGGTCCTTATAATTTTTTATACCAGAGACATGTTCATGGAATCATGGAGGAAGAATAATGAATGCTTGGATGTAGTTTTTGAGGAAGTACGCCCTTGGGCTGAGACTGACACGACTTTGAATCAGATGGCTTGGATAACAATAACAAATCTACCCATTATAGGGTGGAATTGCAGATGCCTCCCGAAGATTTTAGAAAGAACTGGCCAGATGATAGGTTATGATAAAACTACTCTCAAGCATTTTGAACTATCACAGTCACGGATCCTCATTGGTACACAACTGGACAAGGTGAATAAGGTGATTGTTTTGCAACTCAATAATCAAATATATCAGGTTAAGATAGAGGAGATGGACCCTTTACATTACCCAATTGCTAGCTCTATTTCATACACCATGGATGACTTTCAGACATCCCTAGAGCAAGGGGATGGGGATGATGAGGAAGACTCGGTTGATGTGGCCGATGATGTAGACATAGATGAGGACAGAGCAGGTGTGTTTCAATCAGTCGCAAGGACTCTTGGGGACGGCTAG


Protein sequences

Name Description Sequence
TIR-NBS-LRR-TIR type disease resistance protein TIR-NBS-LRR-TIR type disease resistance protein [Populus trichocarpa].

MLDLKIHYKTRINSIVRCVAPPLLLTGRCLCCPMRVRYPFHFFLYFFSTESPSSLQCKIRKKIIGNLPIRVLDLKEPEKIRSHWNKKKVKGFGRIFMASTSVQGITSSSSSPPLYKYDVFLSFRGKDTRNNFTSHLQTNLAQRGIDAYMDDRELERGKTIEPALWKAIEESRFSVIIFSRDYASSPWCLDELVKIVQGMKEMGHTVLPVFYDVDPSETYEKAFVEHEQNFKENLEKVQIWKDCLSTVTNLSGWDIRNRNESESIKIIAEYISYKLSVTLPTISKKLVGIDSRVEVLNGYIGEEVGEAIFIGICGMGGIGKTTVSRVLYDRIRWQFEGSCFLANVREVFAEKDGPRRLQEQLLSEILMERASVWDSSRGIEMIKRRLRLKKILLILDDVDDKKQLEFLAAEPGWFGPRSRIIITSRDKNVFTGNDDTKIYEAEKLNDDDALMLFSQKAFKNDQPAEDFVELSKQVVGYANGLPLALEVIGSFLYGRSIPEWRGAINRMHEIPDCKIMDVLRISFDGLHESDQKIFLDIACFLKGFKKDRITRILDSCGFNAGIGIPVLIERSLISVYGDQVWMHNLLQIMGKEIVRCEDPKEPGKRSRLWTYEDVSLALMDNTGKEKIEAIFLDMPGIKEAQWNMKAFSKMSRLRLLKIDNVQLSEGPEDLSKELRFLEWHSYPSKSLPAGLQVDGLVELHMANSSIEQLWYGCKSAVNLKVINLSNSLNLSKTPDLTGIPNLSSLILEGCTSLSEVHPSLGRHKNLQYVNLVNCKSFRILPSNLEMESLKVFTLDGCTKLEKFPDIVGNMNCLMELCLDGTGIAELSSSIHHLIGLEVLSMNNCKNLESIPSSIGCLKSLKKLDLSGCSELKNIPENLGKVESLEEFDGLSNPRPGFGIAFPGNEIPGWFNHRKLKEWQHGSFSNIELSFHSFQPGVKVKNCGVCLLYYSSSKSSARFIVASKEASSSSFTSSLSVSSSYRQWVQDFFLSFRGADTSNDFIHLNTALALRVIIPDDKELEKVMAIRSRLFEAIEESGLSIIIFARDCASLPWCFDELVKIVGFMDEMRSDTVFPVSYDVKQSKIDDQTESYTIVFDKDEEDFRENEEKVQRWTNILTEVLFSSGPRRLHLTDAELMLYLKRKICENSFKFDTIPDVDVYKWDPEELPELSPLENRQWYFFGPRGRAPRGERTDWEMQEYTLNEKELKGCTNVQDCYALYKLYKNKKRALTSTSQQPQNCNHIRRMALHPHSPPDYELDFQEIHLFGPQPIFSETMQPIENLQFGGGGFSEMDRWYETMFLRDNIEPADQERCLLGKVKKGSYYSAIRFGLLQYDIDFAGLRFLEASQVLIIFYTRDMFMESWRKNNECLDVVFEEVRPWAETDTTLNQMAWITITNLPIIGWNCRCLPKILERTGQMIGYDKTTLKHFELSQSRILIGTQLDKVNKVIVLQLNNQIYQVKIEEMDPLHYPIASSISYTMDDFQTSLEQGDGDDEEDSVDVADDVDIDEDRAGVFQSVARTLGDG

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
105-253 TIR
Toll/interleukin-1 receptor homology (TIR) domain

ITSSSSSPPLYKYDVFLSFRGKDTRNNFTSHLQTNLAQRGIDAYMDDRELERGKTIEPALWKAIEESRFSVIIFSRDYASSPWCLDELVKIVQGMKEMGHTVLPVFYDVDPSETYEKAFVEHEQNFKENLEKVQIWKDCLSTVTNLSGW

Gene3D: G3DSA:3.40.50.10140
115-222 G3DSA:3.40.50.10140

YKYDVFLSFRGKDTRNNFTSHLQTNLAQRGIDAYMDDRELERGKTIEPALWKAIEESRFSVIIFSRDYASSPWCLDELVKIVQGMKEMGHTVLPVFYDVDPSETYEKA

ProfileScan: PS50104
IPR000157
115-253 TIR
Toll/interleukin-1 receptor homology (TIR) domain

YKYDVFLSFRGKDTRNNFTSHLQTNLAQRGIDAYMDDRELERGKTIEPALWKAIEESRFSVIIFSRDYASSPWCLDELVKIVQGMKEMGHTVLPVFYDVDPSETYEKAFVEHEQNFKENLEKVQIWKDCLSTVTNLSGW

HMMSmart: SM00255
IPR000157
116-250 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KYDVFLSFRGKDTRNNFTSHLQTNLAQRGIDAYMDDRELERGKTIEPALWKAIEESRFSVIIFSRDYASSPWCLDELVKIVQGMKEMGHTVLPVFYDVDPSETYEKAFVEHEQNFKENLEKVQIWKDCLSTVTNL

HMMPfam: PF01582
IPR000157
119-237 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGKDTRNNFTSHLQTNLAQRGIDAYMDDRELERGKTIEPALWKAIEESRFSVIIFSRDYASSPWCLDELVKIVQGMKEMGHTVLPVFYDVDPSETYEKAFVEHEQNFKENLEKV

HMMPanther: PTHR11017:SF20
135-885 PTHR11017:SF20,SUBFAMILY NOT NAMED

HLQTNLAQRGIDAYMDDRELERGKTIEPALWKAIEESRFSVIIFSRDYASSPWCLDELVKIVQGMKEMGHTVLPVFYDVDPSETYEKAFVEHEQNFKENLEKVQIWKDCLSTVTNLSGWDIRNRNESESIKIIAEYISYKLSVTLPTISKKLVGIDSRVEVLNGYIGEEVGEAIFIGICGMGGIGKTTVSRVLYDRIRWQFEGSCFLANVREVFAEKDGPRRLQEQLLSEILMERASVWDSSRGIEMIKRRLRLKKILLILDDVDDKKQLEFLAAEPGWFGPRSRIIITSRDKNVFTGNDDTKIYEAEKLNDDDALMLFSQKAFKNDQPAEDFVELSKQVVGYANGLPLALEVIGSFLYGRSIPEWRGAINRMHEIPDCKIMDVLRISFDGLHESDQKIFLDIACFLKGFKKDRITRILDSCGFNAGIGIPVLIERSLISVYGDQVWMHNLLQIMGKEIVRCEDPKEPGKRSRLWTYEDVSLALMDNTGKEKIEAIFLDMPGIKEAQWNMKAFSKMSRLRLLKIDNVQLSEGPEDLSKELRFLEWHSYPSKSLPAGLQVDGLVELHMANSSIEQLWYGCKSAVNLKVINLSNSLNLSKTPDLTGIPNLSSLILEGCTSLSEVHPSLGRHKNLQYVNLVNCKSFRILPSNLEMESLKVFTLDGCTKLEKFPDIVGNMNCLMELCLDGTGIAELSSSIHHLIGLEVLSMNNCKNLESIPSSIGCLKSLKKLDLSGCSELKNIPENLGKVESLE

HMMPanther: PTHR11017
135-885 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

HLQTNLAQRGIDAYMDDRELERGKTIEPALWKAIEESRFSVIIFSRDYASSPWCLDELVKIVQGMKEMGHTVLPVFYDVDPSETYEKAFVEHEQNFKENLEKVQIWKDCLSTVTNLSGWDIRNRNESESIKIIAEYISYKLSVTLPTISKKLVGIDSRVEVLNGYIGEEVGEAIFIGICGMGGIGKTTVSRVLYDRIRWQFEGSCFLANVREVFAEKDGPRRLQEQLLSEILMERASVWDSSRGIEMIKRRLRLKKILLILDDVDDKKQLEFLAAEPGWFGPRSRIIITSRDKNVFTGNDDTKIYEAEKLNDDDALMLFSQKAFKNDQPAEDFVELSKQVVGYANGLPLALEVIGSFLYGRSIPEWRGAINRMHEIPDCKIMDVLRISFDGLHESDQKIFLDIACFLKGFKKDRITRILDSCGFNAGIGIPVLIERSLISVYGDQVWMHNLLQIMGKEIVRCEDPKEPGKRSRLWTYEDVSLALMDNTGKEKIEAIFLDMPGIKEAQWNMKAFSKMSRLRLLKIDNVQLSEGPEDLSKELRFLEWHSYPSKSLPAGLQVDGLVELHMANSSIEQLWYGCKSAVNLKVINLSNSLNLSKTPDLTGIPNLSSLILEGCTSLSEVHPSLGRHKNLQYVNLVNCKSFRILPSNLEMESLKVFTLDGCTKLEKFPDIVGNMNCLMELCLDGTGIAELSSSIHHLIGLEVLSMNNCKNLESIPSSIGCLKSLKKLDLSGCSELKNIPENLGKVESLE

superfamily: SSF52540
269-515 SSF52540

EYISYKLSVTLPTISKKLVGIDSRVEVLNGYIGEEVGEAIFIGICGMGGIGKTTVSRVLYDRIRWQFEGSCFLANVREVFAEKDGPRRLQEQLLSEILMERASVWDSSRGIEMIKRRLRLKKILLILDDVDDKKQLEFLAAEPGWFGPRSRIIITSRDKNVFTGNDDTKIYEAEKLNDDDALMLFSQKAFKNDQPAEDFVELSKQVVGYANGLPLALEVIGSFLYGRSIPEWRGAINRMHEIPDCKI

Gene3D: G3DSA:3.40.50.300
281-401 G3DSA:3.40.50.300

TISKKLVGIDSRVEVLNGYIGEEVGEAIFIGICGMGGIGKTTVSRVLYDRIRWQFEGSCFLANVREVFAEKDGPRRLQEQLLSEILMERASVWDSSRGIEMIKRRLRLKKILLILDDVDDK

HMMPfam: PF00931
IPR002182
294-558 NB-ARC,NBS
NB-ARC

EVLNGYIGEEVGEAIFIGICGMGGIGKTTVSRVLYDRIRWQFEGSCFLANVREVFAEKDGPRRLQEQLLSEILMERASVWDSSRGIEMIKRRLRLKKILLILDDVDDKKQLEFLAAEPGWFGPRSRIIITSRDKNVFTGNDDTKIYEAEKLNDDDALMLFSQKAFKNDQPAEDFVELSKQVVGYANGLPLALEVIGSFLYGRSIPEWRGAINRMHEIPDCKIMDVLRISFDGLHESDQKIFLDIACFLKGFKKDRITRILDSCGF

FPrintScan: PR00364
IPR000767
309-324 DISEASERSIST
Disease resistance protein

FIGICGMGGIGKTTVS

FPrintScan: PR00364
IPR000767
385-399 DISEASERSIST
Disease resistance protein

RLRLKKILLILDDVD

FPrintScan: PR00364
IPR000767
478-492 DISEASERSIST
Disease resistance protein

ANGLPLALEVIGSFL

superfamily: SSF46785
513-619 SSF46785

CKIMDVLRISFDGLHESDQKIFLDIACFLKGFKKDRITRILDSCGFNAGIGIPVLIERSLISVYGDQVWMHNLLQIMGKEIVRCEDPKEPGKRSRLWTYEDVSLALM

superfamily: SSF52058
593-888 SSF52058,LRR

IVRCEDPKEPGKRSRLWTYEDVSLALMDNTGKEKIEAIFLDMPGIKEAQWNMKAFSKMSRLRLLKIDNVQLSEGPEDLSKELRFLEWHSYPSKSLPAGLQVDGLVELHMANSSIEQLWYGCKSAVNLKVINLSNSLNLSKTPDLTGIPNLSSLILEGCTSLSEVHPSLGRHKNLQYVNLVNCKSFRILPSNLEMESLKVFTLDGCTKLEKFPDIVGNMNCLMELCLDGTGIAELSSSIHHLIGLEVLSMNNCKNLESIPSSIGCLKSLKKLDLSGCSELKNIPENLGKVESLEEFD

Gene3D: G3DSA:3.80.10.10
632-892 G3DSA:3.80.10.10

LDMPGIKEAQWNMKAFSKMSRLRLLKIDNVQLSEGPEDLSKELRFLEWHSYPSKSLPAGLQVDGLVELHMANSSIEQLWYGCKSAVNLKVINLSNSLNLSKTPDLTGIPNLSSLILEGCTSLSEVHPSLGRHKNLQYVNLVNCKSFRILPSNLEMESLKVFTLDGCTKLEKFPDIVGNMNCLMELCLDGTGIAELSSSIHHLIGLEVLSMNNCKNLESIPSSIGCLKSLKKLDLSGCSELKNIPENLGKVESLEEFDGLSN

HMMPfam: PF00560
IPR001611
836-857 LRR_1
Leucine-rich repeat

LEVLSMNNCKNLESIPSSIGCL

FPrintScan: PR00364
IPR000767
855-871 DISEASERSIST
Disease resistance protein

GCLKSLKKLDLSGCSEL

HMMPfam: PF00560
IPR001611
859-879 LRR_1
Leucine-rich repeat

SLKKLDLSGCSELKNIPENLG

superfamily: SSF52200
IPR000157
973-1125 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SLSVSSSYRQWVQDFFLSFRGADTSNDFIHLNTALALRVIIPDDKELEKVMAIRSRLFEAIEESGLSIIIFARDCASLPWCFDELVKIVGFMDEMRSDTVFPVSYDVKQSKIDDQTESYTIVFDKDEEDFRENEEKVQRWTNILTEVLFSSGP

ProfileScan: PS50104
IPR000157
983-1119 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WVQDFFLSFRGADTSNDFIHLNTALALRVIIPDDKELEKVMAIRSRLFEAIEESGLSIIIFARDCASLPWCFDELVKIVGFMDEMRSDTVFPVSYDVKQSKIDDQTESYTIVFDKDEEDFRENEEKVQRWTNILTEV

HMMSmart: SM00255
IPR000157
984-1122 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VQDFFLSFRGADTSNDFIHLNTALALRVIIPDDKELEKVMAIRSRLFEAIEESGLSIIIFARDCASLPWCFDELVKIVGFMDEMRSDTVFPVSYDVKQSKIDDQTESYTIVFDKDEEDFRENEEKVQRWTNILTEVLFS

Gene3D: G3DSA:3.40.50.10140
986-1115 G3DSA:3.40.50.10140

DFFLSFRGADTSNDFIHLNTALALRVIIPDDKELEKVMAIRSRLFEAIEESGLSIIIFARDCASLPWCFDELVKIVGFMDEMRSDTVFPVSYDVKQSKIDDQTESYTIVFDKDEEDFRENEEKVQRWTNI

HMMPfam: PF01582
IPR000157
988-1117 TIR
Toll/interleukin-1 receptor homology (TIR) domain

FLSFRGADTSNDFIHLNTALALRVIIPDDKELEKVMAIRSRLFEAIEESGLSIIIFARDCASLPWCFDELVKIVGFMDEMRSDTVFPVSYDVKQSKIDDQTESYTIVFDKDEEDFRENEEKVQRWTNILT

superfamily: SSF101941
IPR003441
1106-1225 NAM
No apical meristem (NAM) protein

EEKVQRWTNILTEVLFSSGPRRLHLTDAELMLYLKRKICENSFKFDTIPDVDVYKWDPEELPELSPLENRQWYFFGPRGRAPRGERTDWEMQEYTLNEKELKGCTNVQDCYALYKLYKNK

HMMPfam: PF02365
IPR003441
1127-1183 NAM
No apical meristem (NAM) protein

RLHLTDAELMLYLKRKICENSFKFDTIPDVDVYKWDPEELPELSPLENRQWYFFGPR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox