PRGDB00047397 (TIR-NBS type disease resistance protein)

From PRG Wiki
Jump to: navigation, search
TIR-NBS type disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 105922753 (DQ513221)
Gene Class T
Domain Type TIR, LRR
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa clone 222069 TIR-NBS type disease resistance protein mRNA, partial cds.

DNA Sequence

ATGTGCGTGGCCCAACCCCTGCTCTTGACAGGAAGGTGCCTCTGCTGCCCAATGCGCGTTCGATATCCCTTTCATTTCTTTCTCTACTGTTTCTCCACCGAAAGTCCAACTTCTTTACAGTGTAAGATCCGTAAGAAAATCATTGGAAACTTACCAATACGAGTTCTTGACCTAAAGGAACCGGAAAAAATTCGATGTCATTGGAATAAAAAGAAAGTCAAGGGCTTTGGAAGTTGTTTTAGAGGCAAAGACACCCGGAACAACTTTACTAGTCATCTATGTTCTAATCTGGCACAGAGAGGCATCGATGTGTACGTGGATGATAGGGAGCTCGAGAGAGGAAAGACCATCGAACCTGCTCTCTGGAAGGCCATCGAAGAATCAAGGTTTTCTGTCATTATATTTTCACGAGATTACGCTTCTTCACCATGGTGCCTGGATGAACTTGTCAAGATTGTTCAGTGCATGAAAGAGACGGGGCACACTGTTCTGCCAGTTTTTTATGATGTGGATCCCTCAGAGGTAGCCGAGCAGAAAGGGCAATATGAGAAAGCCTTCGGTGAGCATGAACAAAATTTCAAGGAAAACTTGGAGAAGGTCCGGAACTGGAAAGATTGTCTCTCTACGGTGGCTAATCTATCAGGCTGGGACGTGCGAGATAGGAATGAGTCGGAATCAATTAAAATAATTGCTGAATACATATCGTACAAACTAAGCGTCACTCTGCCAACAATTAGCAAAAAATTGGTTGGAATAGATTCTCGTCTAGAGGTATTAAATGGCTATATAGGTGAAGAAGTAGGCAAAGCAATCTTCATAGGGATATGTGGAATGG


Protein sequences

Name Description Sequence
TIR-NBS type disease resistance protein TIR-NBS type disease resistance protein [Populus trichocarpa].

MCVAQPLLLTGRCLCCPMRVRYPFHFFLYCFSTESPTSLQCKIRKKIIGNLPIRVLDLKEPEKIRCHWNKKKVKGFGSCFRGKDTRNNFTSHLCSNLAQRGIDVYVDDRELERGKTIEPALWKAIEESRFSVIIFSRDYASSPWCLDELVKIVQCMKETGHTVLPVFYDVDPSEVAEQKGQYEKAFGEHEQNFKENLEKVRNWKDCLSTVANLSGWDVRDRNESESIKIIAEYISYKLSVTLPTISKKLVGIDSRLEVLNGYIGEEVGKAIFIGICGM

Domains

Domain Start-End Description Sequence

HMMSmart: SM00255
IPR000157
72-213 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KVKGFGSCFRGKDTRNNFTSHLCSNLAQRGIDVYVDDRELERGKTIEPALWKAIEESRFSVIIFSRDYASSPWCLDELVKIVQCMKETGHTVLPVFYDVDPSEVAEQKGQYEKAFGEHEQNFKENLEKVRNWKDCLSTVANL

Gene3D: G3DSA:3.40.50.10140
79-206 G3DSA:3.40.50.10140

CFRGKDTRNNFTSHLCSNLAQRGIDVYVDDRELERGKTIEPALWKAIEESRFSVIIFSRDYASSPWCLDELVKIVQCMKETGHTVLPVFYDVDPSEVAEQKGQYEKAFGEHEQNFKENLEKVRNWKDC

superfamily: SSF52200
IPR000157
79-216 TIR
Toll/interleukin-1 receptor homology (TIR) domain

CFRGKDTRNNFTSHLCSNLAQRGIDVYVDDRELERGKTIEPALWKAIEESRFSVIIFSRDYASSPWCLDELVKIVQCMKETGHTVLPVFYDVDPSEVAEQKGQYEKAFGEHEQNFKENLEKVRNWKDCLSTVANLSGW

HMMPfam: PF01582
IPR000157
79-207 TIR
Toll/interleukin-1 receptor homology (TIR) domain

CFRGKDTRNNFTSHLCSNLAQRGIDVYVDDRELERGKTIEPALWKAIEESRFSVIIFSRDYASSPWCLDELVKIVQCMKETGHTVLPVFYDVDPSEVAEQKGQYEKAFGEHEQNFKENLEKVRNWKDCL

ProfileScan: PS50104
IPR000157
80-213 TIR
Toll/interleukin-1 receptor homology (TIR) domain

FRGKDTRNNFTSHLCSNLAQRGIDVYVDDRELERGKTIEPALWKAIEESRFSVIIFSRDYASSPWCLDELVKIVQCMKETGHTVLPVFYDVDPSEVAEQKGQYEKAFGEHEQNFKENLEKVRNWKDCLSTVANL

HMMPanther: PTHR23155
85-278 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TRNNFTSHLCSNLAQRGIDVYVDDRELERGKTIEPALWKAIEESRFSVIIFSRDYASSPWCLDELVKIVQCMKETGHTVLPVFYDVDPSEVAEQKGQYEKAFGEHEQNFKENLEKVRNWKDCLSTVANLSGWDVRDRNESESIKIIAEYISYKLSVTLPTISKKLVGIDSRLEVLNGYIGEEVGKAIFIGICGM

HMMPanther: PTHR23155:SF344
85-278 PTHR23155:SF344

TRNNFTSHLCSNLAQRGIDVYVDDRELERGKTIEPALWKAIEESRFSVIIFSRDYASSPWCLDELVKIVQCMKETGHTVLPVFYDVDPSEVAEQKGQYEKAFGEHEQNFKENLEKVRNWKDCLSTVANLSGWDVRDRNESESIKIIAEYISYKLSVTLPTISKKLVGIDSRLEVLNGYIGEEVGKAIFIGICGM






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox