PRGDB00047400 (TIR-NBS-TIR-TIR-WRKY type disease resistance protein)

From PRG Wiki
Jump to: navigation, search
TIR-NBS-TIR-TIR-WRKY type disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 105922709 (DQ513218)
Gene Class TNL
Domain Type LRR, NBS, TIR, Others
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa clone 196822 TIR-NBS-TIR-TIR-WRKY type disease resistance protein mRNA, complete cds.

DNA Sequence

ATGATTCAAAACGATGGAATGCAGATGCTAGGGCTAAGGAAGGGCGCGAAAAAATATGGTGTTATTCAATGTGACCCACTAGTCCTCAAAGGCCTAGAGAAAACTGGAGCTCGAGAGACCATAGAACCTGCTCTCTGGAAGGCCATCAAAGAATCAAGGTTTACTGTCATTATATTTTCAAGAGATTACGCTCCTTCACAATGGTGCTTGGATGACCTTGTCAAGATTGTTCAGTGCATGAAAGAGATGGGGCACACTGTTCTGCCAGTTTTTTATGATGTGGATCCCTCAGAGACATATGAGAAAGCCTTCGTTGAGCATGAACAAAATTTCAAGGAAAATTTGGAGAATGTCCAGATCTGGAAAGATTGTCTCTCTACGGTGACCAATCTATTTGGCGGGGACGTACGGAAGAGGAAAGAGTCGGAATCAATAAAAATAATTGCTGAATACATATCGTACAAACTAAGCGTCACTCTGCCAACAATTAGCAAAAACTTAGTTGGAATAGATTATCGTCTAGAGGTATTAAATGGCTATATCGGTGAAGAAGTAGGCAAAGCAATCTTCATAGGGATTTGCGGAATGGGTGGCATAGGTAAGACGATCGTGGCAAAGGTATATTATGATAGGATTCGTTGGCAATTCGAAGGCAGCTGCTTCTTAGCAAATGTCAGAGAAGTTTTTGCTGAGAAAGATGGACCACGTCGTTTGCAGGAACAACTTCTTTCTGAAATCTTGATGGAACGTGCTTCTGTATGGGATTCTTCTAGAGGGATTGAGATGATAAAGCGGAGGTTACGACTTAAAAAGATTCTTCTTATCCTTGATGATGTAGATGACAAAGAACAACTAGAATTCTTGGCTGAGGAGCCTGGATGGTGTGGTCCAGGGAGCAGAATTATCGTAACTAGAAGAGATAAAAAAGTGGTTACTGGAAATAATAATTATAACATTTATGAGGCTGAGAAATTGAATGATGATGATGCTCTTATGTTGTTTAGCCAGAAAGCTTTCAAAAATGACCAGCCTGCTGTAGATTTCGTGGAACTATCCAAGCATGTTGTGGGTTATGCTAATGGCCTTCCACTAGCTCTTGAAGTTATAGGTTCGTTTTTGTATGAAAGAAGTATCCATGAATGGAGAGGTGCAATTAATAGAATGAATGAGATTCCTGACGGCAAAATTATTGACGTGCTTCGCATTAGTTTTGATGGTATTGGATTACCAATTCTTATTGAGAGATCTCTCATAAGTGTCTCTCGGGATCAAGTCTGGATGGATAATTTATTACAGATAATGGGTAAGGAAATTGTTCGTTGCGAATCCCCTGAAGAGCTTGGAAGGCGCAGTAGACTGTGGACATACGAGGATGTCTGCCTTGCACTGATGGACAGCACAAGTGCAGTTAATTTGAAAATCATCAATCTCAGCAACTCACTAAACCTGTCCAGGACTCCAGATCTTACTGGAATTCCAAATCTCGAGAGTCTGATTCTTGAAGGTTGTACAAGTTTGTCTAAGATCCATCCATCACTTGGAAGTCACAAGAATCTTCAATATGTGAATCTTGTGAATTGCGAAAGTATTAGGATTCTCCCAAGCAACCTTGAAATGGAATCGCTTAAAGTTTTCACTCTTGATGGCTGCTCAAAACTTGAGAAGTTTCCAGATGTACTAGGAAACATGAACTGTTTGATGGTGCTTTGTTTGGACGAGACTGAGCTTAAAGAATGGCAGCACGGATCCTTTAGCAACATTGAGCTGTCATTTCATTCTTTCCAGCCAGGAGTAAAGGTGAAGAATTGTGGTGTCTGTTTGTTATATTCTCTATCATCTCAATCTTCTGCCCATTTTATTGTTGCAAGCAAAGAAGCATCTTCTTCATATAAAGCTTCTTTATCGGTGTCTTCATCTTACCGTCAATGGATGGAAGATCTTTTCCTTAGCTTCAGAGGCGCAGACACTAGCAATGATTTCACCCATTTAAATACAGCTCTAGCCCTGAGAGTCATTATTCCAGACGACAAGGAACTAGAGAAAGTGATGGCAATTAGATCAAGACTCCTAGAGGCCATTGAAGAATCAGGGCTGTCAATTATTATATTTGCAAGAGATTGTGCTTCTTTACCTTGGTGCTTTGACGAACTTGTCAAGATTGTCGGATTCATTGATGAAATGAGATCGGACACTGTGTTTCCAGTTTCTTATCATGTTGAACAATCAAAGATAGATGATCAAACAGAGAGTTACACGATTTTCTTTGATAAGAATGAAGAAAATTCCAGGGAAAACGAGGAGAAGGTACAAAGATGGATGAATATTTTCAGTGAAGTTGAGATTCCATCTGGATCGAGATCAGTGGAAAGGAAGATCCGTAAGAAAATCATTGGAAACTTACCAGTACGAGTTCTTGACCTCAAGAAACCGGAAAAAATTCGAATTTTAGAGGCAAAGACACCCGGAACAACTTTACTAGTCATCTATATTATAATCTGGCACAGAGAGGCATCGATGTATACATGGATGATAGGGAGCTCGAGAGAGGAAAGACCATCGAACCTGCTCTCTGGAAGGCCATTCGAAGAATCAAGGTTTTCTATCATTATATTTTCAAGAGATTACGCTTCTTCACCATGGTGTTTGGAAGAACTTGTCAAGATTGTTCAATGCATGAAAGAGAAGGGTCACACTGTTCTGCCAGTTTTTTATAATGTGGATCCCTCAGAGACATATGAGAAAGCCTTCGTTGAGCATGAACAAAATTTCAAGGAAAACTTGGAGAAGGTCCGGAACTGGAAAGATTGTCTCTCTACGGTGGCCAATCTATCTGGCTGGGACGTCCGGAATAGAGATTGTGCTTCTTTACCTTGGTGCTTTGACGAACTTGTCAAGATTGTCGGATTCATTGATGAAATGAGATCGGACACTGTGTTTCCAGTTTCTTGTGATGTTGAACAATCAAAGATAAATGATCAAACAGAGAGTTACACAATTGTCTTTGATAAGATTGGAAAAAATCTCAGGGAAAACGAGGAGAAGGTACAAAGATGGATGGATATTCTCAGTGAAGTTGAGATTTCATCTGGATCGAGATCAGCGGAAAGGTTTACCATGCAGGGATGGGGACAAGAATGTCCAGGTTTCAGGAAGAGTCAAGCCAAGAAGGTAGTTTGTATTCCAGCACCAGCTGCTGCAAACAGCAGGTCTAGTGGAGAAGTAGTTCCATCTGACTTGTGGGCATGGAAAAAATATGGACAAAAACACATCAAGGGTTCTCCTTATCCAAGAGGTTACTACAGATGCAGCAGCTCTAAGGGTTGCTTAGCAAAGAAGCACGTAGAGCGGAGCCGAAATGATCCTAACATGTTGGTCATCACCTACAATTCTGAGCATAACCATCCATGGCCAACACAGAGAAATGCACTTGCTGGCTCAACAAGGTCTCAGCCAACAAAGAGCAATGCAGCTTCAAAGAGCTCCACAGGTGCTCAAGCACGAAAAACAGCAAATACAAAGGAAGATCAGAAGGAGAGTAGCAATGATACATTGTCTCCTACCGATATTATTGGTGGTAGCTCAACAGCAAGCGCATCTGTTAAAGAGGAGTCTGATGACATTGAGAAGCAGATGGAGATGGATGATAATGAATTCAGTGAAGGGTTTTCTCAGAGTTACTGTTGGTGGGAAAGACCACTAGTTGTGACTTTTAAATACTCAGAGGAGATAAAACACATTGTTTTTATTTCAAAATAA


Protein sequences

Name Description Sequence
TIR-NBS-TIR-TIR-WRKY type disease resistance protein TIR-NBS-TIR-TIR-WRKY type disease resistance protein [Populus trichocarpa].

MIQNDGMQMLGLRKGAKKYGVIQCDPLVLKGLEKTGARETIEPALWKAIKESRFTVIIFSRDYAPSQWCLDDLVKIVQCMKEMGHTVLPVFYDVDPSETYEKAFVEHEQNFKENLENVQIWKDCLSTVTNLFGGDVRKRKESESIKIIAEYISYKLSVTLPTISKNLVGIDYRLEVLNGYIGEEVGKAIFIGICGMGGIGKTIVAKVYYDRIRWQFEGSCFLANVREVFAEKDGPRRLQEQLLSEILMERASVWDSSRGIEMIKRRLRLKKILLILDDVDDKEQLEFLAEEPGWCGPGSRIIVTRRDKKVVTGNNNYNIYEAEKLNDDDALMLFSQKAFKNDQPAVDFVELSKHVVGYANGLPLALEVIGSFLYERSIHEWRGAINRMNEIPDGKIIDVLRISFDGIGLPILIERSLISVSRDQVWMDNLLQIMGKEIVRCESPEELGRRSRLWTYEDVCLALMDSTSAVNLKIINLSNSLNLSRTPDLTGIPNLESLILEGCTSLSKIHPSLGSHKNLQYVNLVNCESIRILPSNLEMESLKVFTLDGCSKLEKFPDVLGNMNCLMVLCLDETELKEWQHGSFSNIELSFHSFQPGVKVKNCGVCLLYSLSSQSSAHFIVASKEASSSYKASLSVSSSYRQWMEDLFLSFRGADTSNDFTHLNTALALRVIIPDDKELEKVMAIRSRLLEAIEESGLSIIIFARDCASLPWCFDELVKIVGFIDEMRSDTVFPVSYHVEQSKIDDQTESYTIFFDKNEENSRENEEKVQRWMNIFSEVEIPSGSRSVERKIRKKIIGNLPVRVLDLKKPEKIRILEAKTPGTTLLVIYIIIWHREASMYTWMIGSSREERPSNLLSGRPFEESRFSIIIFSRDYASSPWCLEELVKIVQCMKEKGHTVLPVFYNVDPSETYEKAFVEHEQNFKENLEKVRNWKDCLSTVANLSGWDVRNRDCASLPWCFDELVKIVGFIDEMRSDTVFPVSCDVEQSKINDQTESYTIVFDKIGKNLRENEEKVQRWMDILSEVEISSGSRSAERFTMQGWGQECPGFRKSQAKKVVCIPAPAAANSRSSGEVVPSDLWAWKKYGQKHIKGSPYPRGYYRCSSSKGCLAKKHVERSRNDPNMLVITYNSEHNHPWPTQRNALAGSTRSQPTKSNAASKSSTGAQARKTANTKEDQKESSNDTLSPTDIIGGSSTASASVKEESDDIEKQMEMDDNEFSEGFSQSYCWWERPLVVTFKYSEEIKHIVFISK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF20
17-579 PTHR11017:SF20,SUBFAMILY NOT NAMED

KKYGVIQCDPLVLKGLEKTGARETIEPALWKAIKESRFTVIIFSRDYAPSQWCLDDLVKIVQCMKEMGHTVLPVFYDVDPSETYEKAFVEHEQNFKENLENVQIWKDCLSTVTNLFGGDVRKRKESESIKIIAEYISYKLSVTLPTISKNLVGIDYRLEVLNGYIGEEVGKAIFIGICGMGGIGKTIVAKVYYDRIRWQFEGSCFLANVREVFAEKDGPRRLQEQLLSEILMERASVWDSSRGIEMIKRRLRLKKILLILDDVDDKEQLEFLAEEPGWCGPGSRIIVTRRDKKVVTGNNNYNIYEAEKLNDDDALMLFSQKAFKNDQPAVDFVELSKHVVGYANGLPLALEVIGSFLYERSIHEWRGAINRMNEIPDGKIIDVLRISFDGIGLPILIERSLISVSRDQVWMDNLLQIMGKEIVRCESPEELGRRSRLWTYEDVCLALMDSTSAVNLKIINLSNSLNLSRTPDLTGIPNLESLILEGCTSLSKIHPSLGSHKNLQYVNLVNCESIRILPSNLEMESLKVFTLDGCSKLEKFPDVLGNMNCLMVLCLDETELKEW

HMMPanther: PTHR11017
17-579 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KKYGVIQCDPLVLKGLEKTGARETIEPALWKAIKESRFTVIIFSRDYAPSQWCLDDLVKIVQCMKEMGHTVLPVFYDVDPSETYEKAFVEHEQNFKENLENVQIWKDCLSTVTNLFGGDVRKRKESESIKIIAEYISYKLSVTLPTISKNLVGIDYRLEVLNGYIGEEVGKAIFIGICGMGGIGKTIVAKVYYDRIRWQFEGSCFLANVREVFAEKDGPRRLQEQLLSEILMERASVWDSSRGIEMIKRRLRLKKILLILDDVDDKEQLEFLAEEPGWCGPGSRIIVTRRDKKVVTGNNNYNIYEAEKLNDDDALMLFSQKAFKNDQPAVDFVELSKHVVGYANGLPLALEVIGSFLYERSIHEWRGAINRMNEIPDGKIIDVLRISFDGIGLPILIERSLISVSRDQVWMDNLLQIMGKEIVRCESPEELGRRSRLWTYEDVCLALMDSTSAVNLKIINLSNSLNLSRTPDLTGIPNLESLILEGCTSLSKIHPSLGSHKNLQYVNLVNCESIRILPSNLEMESLKVFTLDGCSKLEKFPDVLGNMNCLMVLCLDETELKEW

HMMSmart: SM00255
IPR000157
23-131 TIR
Toll/interleukin-1 receptor homology (TIR) domain

QCDPLVLKGLEKTGARETIEPALWKAIKESRFTVIIFSRDYAPSQWCLDDLVKIVQCMKEMGHTVLPVFYDVDPSETYEKAFVEHEQNFKENLENVQIWKDCLSTVTNL

Gene3D: G3DSA:3.40.50.10140
38-101 G3DSA:3.40.50.10140

RETIEPALWKAIKESRFTVIIFSRDYAPSQWCLDDLVKIVQCMKEMGHTVLPVFYDVDPSETYE

ProfileScan: PS50104
IPR000157
39-131 TIR
Toll/interleukin-1 receptor homology (TIR) domain

ETIEPALWKAIKESRFTVIIFSRDYAPSQWCLDDLVKIVQCMKEMGHTVLPVFYDVDPSETYEKAFVEHEQNFKENLENVQIWKDCLSTVTNL

HMMPfam: PF01582
IPR000157
39-117 TIR
Toll/interleukin-1 receptor homology (TIR) domain

ETIEPALWKAIKESRFTVIIFSRDYAPSQWCLDDLVKIVQCMKEMGHTVLPVFYDVDPSETYEKAFVEHEQNFKENLEN

superfamily: SSF52200
IPR000157
39-133 TIR
Toll/interleukin-1 receptor homology (TIR) domain

ETIEPALWKAIKESRFTVIIFSRDYAPSQWCLDDLVKIVQCMKEMGHTVLPVFYDVDPSETYEKAFVEHEQNFKENLENVQIWKDCLSTVTNLFG

superfamily: SSF52540
150-396 SSF52540

EYISYKLSVTLPTISKNLVGIDYRLEVLNGYIGEEVGKAIFIGICGMGGIGKTIVAKVYYDRIRWQFEGSCFLANVREVFAEKDGPRRLQEQLLSEILMERASVWDSSRGIEMIKRRLRLKKILLILDDVDDKEQLEFLAEEPGWCGPGSRIIVTRRDKKVVTGNNNYNIYEAEKLNDDDALMLFSQKAFKNDQPAVDFVELSKHVVGYANGLPLALEVIGSFLYERSIHEWRGAINRMNEIPDGKI

HMMPfam: PF00931
IPR002182
185-405 NB-ARC,NBS
NB-ARC

VGKAIFIGICGMGGIGKTIVAKVYYDRIRWQFEGSCFLANVREVFAEKDGPRRLQEQLLSEILMERASVWDSSRGIEMIKRRLRLKKILLILDDVDDKEQLEFLAEEPGWCGPGSRIIVTRRDKKVVTGNNNYNIYEAEKLNDDDALMLFSQKAFKNDQPAVDFVELSKHVVGYANGLPLALEVIGSFLYERSIHEWRGAINRMNEIPDGKIIDVLRISFD

FPrintScan: PR00364
IPR000767
190-205 DISEASERSIST
Disease resistance protein

FIGICGMGGIGKTIVA

FPrintScan: PR00364
IPR000767
266-280 DISEASERSIST
Disease resistance protein

RLRLKKILLILDDVD

FPrintScan: PR00364
IPR000767
359-373 DISEASERSIST
Disease resistance protein

ANGLPLALEVIGSFL

superfamily: SSF52058
438-588 SSF52058,LRR

IVRCESPEELGRRSRLWTYEDVCLALMDSTSAVNLKIINLSNSLNLSRTPDLTGIPNLESLILEGCTSLSKIHPSLGSHKNLQYVNLVNCESIRILPSNLEMESLKVFTLDGCSKLEKFPDVLGNMNCLMVLCLDETELKEWQHGSFSNIE

Gene3D: G3DSA:3.80.10.10
441-578 G3DSA:3.80.10.10

CESPEELGRRSRLWTYEDVCLALMDSTSAVNLKIINLSNSLNLSRTPDLTGIPNLESLILEGCTSLSKIHPSLGSHKNLQYVNLVNCESIRILPSNLEMESLKVFTLDGCSKLEKFPDVLGNMNCLMVLCLDETELKE

FPrintScan: PR00364
IPR000767
537-553 DISEASERSIST
Disease resistance protein

LEMESLKVFTLDGCSKL

superfamily: SSF52200
IPR000157
633-785 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SLSVSSSYRQWMEDLFLSFRGADTSNDFTHLNTALALRVIIPDDKELEKVMAIRSRLLEAIEESGLSIIIFARDCASLPWCFDELVKIVGFIDEMRSDTVFPVSYHVEQSKIDDQTESYTIFFDKNEENSRENEEKVQRWMNIFSEVEIPSGS

ProfileScan: PS50104
IPR000157
643-782 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WMEDLFLSFRGADTSNDFTHLNTALALRVIIPDDKELEKVMAIRSRLLEAIEESGLSIIIFARDCASLPWCFDELVKIVGFIDEMRSDTVFPVSYHVEQSKIDDQTESYTIFFDKNEENSRENEEKVQRWMNIFSEVEIP

HMMSmart: SM00255
IPR000157
644-782 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MEDLFLSFRGADTSNDFTHLNTALALRVIIPDDKELEKVMAIRSRLLEAIEESGLSIIIFARDCASLPWCFDELVKIVGFIDEMRSDTVFPVSYHVEQSKIDDQTESYTIFFDKNEENSRENEEKVQRWMNIFSEVEIP

Gene3D: G3DSA:3.40.50.10140
646-772 G3DSA:3.40.50.10140

DLFLSFRGADTSNDFTHLNTALALRVIIPDDKELEKVMAIRSRLLEAIEESGLSIIIFARDCASLPWCFDELVKIVGFIDEMRSDTVFPVSYHVEQSKIDDQTESYTIFFDKNEENSRENEEKVQRW

HMMPfam: PF01582
IPR000157
648-775 TIR
Toll/interleukin-1 receptor homology (TIR) domain

FLSFRGADTSNDFTHLNTALALRVIIPDDKELEKVMAIRSRLLEAIEESGLSIIIFARDCASLPWCFDELVKIVGFIDEMRSDTVFPVSYHVEQSKIDDQTESYTIFFDKNEENSRENEEKVQRWMNI

HMMSmart: SM00255
IPR000157
827-943 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VIYIIIWHREASMYTWMIGSSREERPSNLLSGRPFEESRFSIIIFSRDYASSPWCLEELVKIVQCMKEKGHTVLPVFYNVDPSETYEKAFVEHEQNFKENLEKVRNWKDCLSTVANL

ProfileScan: PS50104
IPR000157
861-946 TIR
Toll/interleukin-1 receptor homology (TIR) domain

FEESRFSIIIFSRDYASSPWCLEELVKIVQCMKEKGHTVLPVFYNVDPSETYEKAFVEHEQNFKENLEKVRNWKDCLSTVANLSGW

HMMPfam: PF01582
IPR000157
861-934 TIR
Toll/interleukin-1 receptor homology (TIR) domain

FEESRFSIIIFSRDYASSPWCLEELVKIVQCMKEKGHTVLPVFYNVDPSETYEKAFVEHEQNFKENLEKVRNWK

superfamily: SSF52200
IPR000157
862-946 TIR
Toll/interleukin-1 receptor homology (TIR) domain

EESRFSIIIFSRDYASSPWCLEELVKIVQCMKEKGHTVLPVFYNVDPSETYEKAFVEHEQNFKENLEKVRNWKDCLSTVANLSGW

Gene3D: G3DSA:3.40.50.10140
862-920 G3DSA:3.40.50.10140

EESRFSIIIFSRDYASSPWCLEELVKIVQCMKEKGHTVLPVFYNVDPSETYEKAFVEHE

superfamily: SSF52200
IPR000157
951-1031 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RDCASLPWCFDELVKIVGFIDEMRSDTVFPVSCDVEQSKINDQTESYTIVFDKIGKNLRENEEKVQRWMDILSEVEISSGS

HMMPfam: PF01582
IPR000157
953-1023 TIR
Toll/interleukin-1 receptor homology (TIR) domain

CASLPWCFDELVKIVGFIDEMRSDTVFPVSCDVEQSKINDQTESYTIVFDKIGKNLRENEEKVQRWMDILS

superfamily: SSF118290
IPR003657
1067-1138 SSF118290
DNA-binding WRKY

NSRSSGEVVPSDLWAWKKYGQKHIKGSPYPRGYYRCSSSKGCLAKKHVERSRNDPNMLVITYNSEHNHPWPT

Gene3D: G3DSA:2.20.25.80
IPR003657
1070-1137 WRKY_DNA-bd
DNA-binding WRKY

SSGEVVPSDLWAWKKYGQKHIKGSPYPRGYYRCSSSKGCLAKKHVERSRNDPNMLVITYNSEHNHPWP

ProfileScan: PS50811
IPR003657
1071-1137 WRKY
DNA-binding WRKY

SGEVVPSDLWAWKKYGQKHIKGSPYPRGYYRCSSSKGCLAKKHVERSRNDPNMLVITYNSEHNHPWP

HMMSmart: SM00774
IPR003657
1076-1136 WRKY
DNA-binding WRKY

PSDLWAWKKYGQKHIKGSPYPRGYYRCSSSKGCLAKKHVERSRNDPNMLVITYNSEHNHPW

HMMPfam: PF03106
IPR003657
1077-1135 WRKY
DNA-binding WRKY

SDLWAWKKYGQKHIKGSPYPRGYYRCSSSKGCLAKKHVERSRNDPNMLVITYNSEHNHP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox