PRGDB00047405 (TIR-NBS-LRR-TIR type disease resistance protein)

From PRG Wiki
Jump to: navigation, search
TIR-NBS-LRR-TIR type disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 105922630 (DQ513213)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, TIR, Others
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa clone 11476 TIR-NBS-LRR-TIR type disease resistance protein mRNA, partial cds.

DNA Sequence

TTTTAGAGGCAAAGACACCCGGAACAACTTTACTAGTCATCTATATTCTAATCTGAAACAGAGAGGCATCGATGTATACATGGATGATAGAGAGCTCGAGAGAGGAAAGACCATCGAACCTGCTCTCTGGAAGGCCATCGAAGAATCAAGGTTTTCTGTCATTATATTTTCAAGAGATTACGCTTCTTCACCATGGTGCTTGGATGAACTTGTCAAGATTGTTCAGTGCATGAAAGAGACGGGGCACACTGTTCTGCCAGTTTTTTATGATGTGGATCCCTCAGAGGTAGCCGAGCAGAAAGGGCAATATGAGAAAGCCTTCGTTGAGCATGAACAAAATTTCAAGGAAAACTTGGAGAAGGTCCAGATCTGGAAAGATTGTCTCTCTACGGTGACCAATCTATCTGGCTGGGACGTACGGAATAGGAATGAATCGGAATCAATTAAAATAATTGTTGAATACATATCGTACAAACTAAGCGTCACTCTGCCAACAATTAGCAAAAAATTAGTTGGAATAGATTCTCGTGTAAAGGTATTAAATGGCTATATAGGTGAAGAAGTAGGCAAAGCAATCTTCATAGGGATTTGCGGAATGGGTGGCATAGGTAAGACGACTGTTGCAAGGGTACTATATGATAAGATTCGTTGGCAATTTGAAGGCAGCTACTTCTTAGCAAATGTCAGGGAAGTTTTTGCTGAGAAAGGTGGACCACGCCGTTTACAGGAACAACTTCTTTCTGAAATCTTAATGGAATGTGCTTCTCTAAAGGATTCTTATAGAGGGATTGAGATGATAAAGCGGAGGTTACGACTTAAAAAGATTCTTCTTATCCTTGATGATGTAGATGACAAAAAACAACTAGAATTCTTGGCTGCGGAGCCTGGATGGTTTGGTCCAGGGAGCAGAATTATCATAACAAGCAGAGATACAAATGTGTTTACTGGAAATGATGATACTAAAATTTATGAGGCTGAGAAATTGAATGATGATGATGCTCTTATGTTATTCAACCAGAAAGCTTTCAAAAATGATCAACCTACTGAAGATTTCGTGAAACTATCCAAGCAAGTTGTGGGTTATGCTAATGGCCTTCCACTGGCTCTAGAAGTTATAGACATTGCTTGTTTCCTGAAGGGGTTTGAAAAAGATCGAATAATAAGGATACTTGACAGCTGTGGATTCCATGCACATATTGGAACACAAGTTCTTATTGAGAGATCTCTCATTAGTGTCTATCGGGATCAAGTCTGGATGCATGATTTATTACAGATAATGGGTAAGGAAATTGTTCGTTCTGAATCCAGTGAAGAGCCTGGAAGGCGCAGTAGATTGTGGACATTCGAGGATGTCCGCCTTGCACTGATGGACAACACAGGAAAAGAAAAAATAGAAGCCATTTTCTTGGACATGCCTGAAATAAAAGAGGCACAATGGAACATGGAAGCCTTCTCTAAAATGAGCAGACTAAGATTGCTCAAAATCGACAACGTGCAGCTTTCTGAAGGACCTGAAGATCTTTCCAATAAGTTGCGATTTCTTGAATGGCATTCTTACCCTTCAAAATCATTGCCAGCTGGTTTACAGGTGGATGAGCTAGTTGAACTTCACATGGCTAACAGTAGTATTGAGCAATTATGGTATGGGTGTAAGAGTGCAGTTAATTTGAAAATCATCAATCTCAGCAACTCACTAAACCTGTCCAAGACTCCAGATCTTACTGGAATTCCAAATCTCGAGAGTCTGATTCTTGAAGGTTGTACAAGTTTGTCTAAGGTCCATCCATCACTTGCACATCACAAGAAGCTTCAATATATGAATCTTGTGAACTGCAAAAGCATTAGGATTCTCCCGAACAACCTTGAAATGGAATCGCTTAAAGTTTTCACTCTTGATGGCTGCTCAAAACTTGAGAAGTTTCCAGATATAGTGGGAAACATGAATTGTTTGATGGAGCTTCGTTTGGATGGGACAGGTGTTGAAGAACTATCTTCATCAATTCATCATTTGATTAGCTTAGAAGTATTGAGCATGAACAACTGCAAGAACCTTGAAAGCATTCCAAGTAGCATAGGTTGTTTGAAATCCCTTAAAAAACTTGATCTGTCTGGCTGCTCTGAACTTAAGAATTTGGAGAAAGTTGAAAGTTCAGAGGAGTTTGATGCAAGTGGAACTTCAATAAGACAACCGCCGGCGCCCATTTTTCTTTTAAAGAATCTTAAAGTATTATCTTTTGATGGATGCAAAAGAATAGCTGTGAGTCTCACGGATCAAAGGTTGCCTTCTTTATCGGGTCTGTGTTCTTTAGAAGTACTGGATTTATGCGCATGCAATCTAAGAGAAGGGGCACTTCCTGAAGATATTGGCTGCTTATCTTCATTGAAGTCTTTAGATCTGAGCCGAAATAACTTTGTTAGCCTGCCTAGGAGCGTAAATCAGCTTTCTGGACTTGAAATGCTTGTCTTGGAGGATTGTAGGATGCTTGAATCATTGCCTGAGGTTCCATCAAAAGTTCAAACAGTAAATTTGAATGGTTGTACAAGCCTAAAAGAAATTCCAGATCCGATAAAGCTAAGCAGTTCCAAAATCTCAGAATTCCTATGTCTTAACTGCTGGGAATTGTACGAGCACAATGGCCAAGATAGCATGGGGCTGACCATGCTTGAAAGATACCTCCAGGGTTTGTCTAATCCAAGACCTGGATTTGGTATCGCTGTTCCAGGAAATGAAATTCCAGGCTGGTTTAACCATCAAAGTAAGGGATCTTCAATTAGTGTGCAAGTGCCTAGTTGGAGCATGGGGTTTGTTGCATGTGTTGCATTCAGTGCATATGGAGAAAGACCTTTTCTTCGTTGTGATTTCAAAGCCAATGGAAGAGAGAATTATCCTTCACTGATGTGTATTAACTCTATCCAAGTTCTGTCAGATCATATTTGGTTATTCTATCTATCTTTTGATTACCTTAAAGAGCTCAAAGAATGGCAGAATGAATCCTTCAGCAACATTGAGTTGTCATTTCATTCTTACGAGCGACGAGTAAAGGTGAAGAATTGTGGTGTCTGTTTGTTATCTTCTGTATGTATTACAGCACAACCATCTTCTGCCCATTTTATTGTCACAAGCAAAGAAGCAGCTTCTTCGTATAAAGCTTCTTTAGCTTTTTCTTGGTCGTACCATCAATGGAAGGCCAATGTTTTCCCTGTCATTAGAGTCGCAGACACTAGTAATTCTTTCAGCTATTTACAGTCAGATCTAGCCCTGAGATTCATTATGTCAGTCGAGAAGGAACCAGAGAAAATAATGGCAATTAGATCAAGACTCTTTGAGGCCATTGAAGAATCAGGGCTGTCAATTATTATATTTGCAAGAGATTGTGTTTCTTTACCTTGGTGCTTTGAAGAACTTGTCAAGATTGTCGGATTCATGGATGAGATGAGATCGGACACTGTGTTTCCAGTTTCTTATGATGTCGAACAATCAAAGATAGATGATCAAACAGAGAGTTACACAATTGTCTTTGATAAGAATGAAGAAAATCTCAGGGAAAACGAGGAGAAGGTACAAAGATGGACGAATATTCTCAGTGAAGTTGAGATTTCATCTGGATCGAAAAGCGGCATAGGAGCTCCAGCAACGCAGCAGCAGCAGCGGATCCAGCATCTCCAGCTGCTCAAGTGGCGGCAGGGATCAGCTGCTGCAGCTCCTCGAGCAGCAGCTGCTGCAGCTCCTCGAGCAGCAGCAGCTCCTCGAGCAGCTGCAGCTCCTCGAGCTGCAGCTCGAGCAGCAGCAGAAGCTCGAGCAGCAGCTCGAGCAGCAGCTGCAGCTCGAGCTGCAGCAGCTGCAGCTCGAGCTGCAGCGCGATCAGCAGGTGCTCCCGCTCCAGCAGAAGCTCCAGCAGCAGAGGGTGCTCCAGCAGCAGCTGCAGCGGGTGCTCCAGCAGCAGCTGCAGCGGGTGCTCCAGCTGCAGCAGCTGCTCCAGCAGCAGCTGCCTGGGTTTTGGTTAGAATTTAA


Protein sequences

Name Description Sequence
TIR-NBS-LRR-TIR type disease resistance protein TIR-NBS-LRR-TIR type disease resistance protein [Populus trichocarpa].

FRGKDTRNNFTSHLYSNLKQRGIDVYMDDRELERGKTIEPALWKAIEESRFSVIIFSRDYASSPWCLDELVKIVQCMKETGHTVLPVFYDVDPSEVAEQKGQYEKAFVEHEQNFKENLEKVQIWKDCLSTVTNLSGWDVRNRNESESIKIIVEYISYKLSVTLPTISKKLVGIDSRVKVLNGYIGEEVGKAIFIGICGMGGIGKTTVARVLYDKIRWQFEGSYFLANVREVFAEKGGPRRLQEQLLSEILMECASLKDSYRGIEMIKRRLRLKKILLILDDVDDKKQLEFLAAEPGWFGPGSRIIITSRDTNVFTGNDDTKIYEAEKLNDDDALMLFNQKAFKNDQPTEDFVKLSKQVVGYANGLPLALEVIDIACFLKGFEKDRIIRILDSCGFHAHIGTQVLIERSLISVYRDQVWMHDLLQIMGKEIVRSESSEEPGRRSRLWTFEDVRLALMDNTGKEKIEAIFLDMPEIKEAQWNMEAFSKMSRLRLLKIDNVQLSEGPEDLSNKLRFLEWHSYPSKSLPAGLQVDELVELHMANSSIEQLWYGCKSAVNLKIINLSNSLNLSKTPDLTGIPNLESLILEGCTSLSKVHPSLAHHKKLQYMNLVNCKSIRILPNNLEMESLKVFTLDGCSKLEKFPDIVGNMNCLMELRLDGTGVEELSSSIHHLISLEVLSMNNCKNLESIPSSIGCLKSLKKLDLSGCSELKNLEKVESSEEFDASGTSIRQPPAPIFLLKNLKVLSFDGCKRIAVSLTDQRLPSLSGLCSLEVLDLCACNLREGALPEDIGCLSSLKSLDLSRNNFVSLPRSVNQLSGLEMLVLEDCRMLESLPEVPSKVQTVNLNGCTSLKEIPDPIKLSSSKISEFLCLNCWELYEHNGQDSMGLTMLERYLQGLSNPRPGFGIAVPGNEIPGWFNHQSKGSSISVQVPSWSMGFVACVAFSAYGERPFLRCDFKANGRENYPSLMCINSIQVLSDHIWLFYLSFDYLKELKEWQNESFSNIELSFHSYERRVKVKNCGVCLLSSVCITAQPSSAHFIVTSKEAASSYKASLAFSWSYHQWKANVFPVIRVADTSNSFSYLQSDLALRFIMSVEKEPEKIMAIRSRLFEAIEESGLSIIIFARDCVSLPWCFEELVKIVGFMDEMRSDTVFPVSYDVEQSKIDDQTESYTIVFDKNEENLRENEEKVQRWTNILSEVEISSGSKSGIGAPATQQQQRIQHLQLLKWRQGSAAAAPRAAAAAAPRAAAAPRAAAAPRAAARAAAEARAAARAAAAARAAAAAARAAARSAGAPAPAEAPAAEGAPAAAAAGAPAAAAAGAPAAAAAPAAAAWVLVRI

Domains

Domain Start-End Description Sequence

ProfileScan: PS50104
IPR000157
1-134 TIR
Toll/interleukin-1 receptor homology (TIR) domain

FRGKDTRNNFTSHLYSNLKQRGIDVYMDDRELERGKTIEPALWKAIEESRFSVIIFSRDYASSPWCLDELVKIVQCMKETGHTVLPVFYDVDPSEVAEQKGQYEKAFVEHEQNFKENLEKVQIWKDCLSTVTNL

HMMPfam: PF01582
IPR000157
1-128 TIR
Toll/interleukin-1 receptor homology (TIR) domain

FRGKDTRNNFTSHLYSNLKQRGIDVYMDDRELERGKTIEPALWKAIEESRFSVIIFSRDYASSPWCLDELVKIVQCMKETGHTVLPVFYDVDPSEVAEQKGQYEKAFVEHEQNFKENLEKVQIWKDCL

HMMSmart: SM00255
IPR000157
1-134 TIR
Toll/interleukin-1 receptor homology (TIR) domain

FRGKDTRNNFTSHLYSNLKQRGIDVYMDDRELERGKTIEPALWKAIEESRFSVIIFSRDYASSPWCLDELVKIVQCMKETGHTVLPVFYDVDPSEVAEQKGQYEKAFVEHEQNFKENLEKVQIWKDCLSTVTNL

Gene3D: G3DSA:3.40.50.10140
1-124 G3DSA:3.40.50.10140

FRGKDTRNNFTSHLYSNLKQRGIDVYMDDRELERGKTIEPALWKAIEESRFSVIIFSRDYASSPWCLDELVKIVQCMKETGHTVLPVFYDVDPSEVAEQKGQYEKAFVEHEQNFKENLEKVQIW

superfamily: SSF52200
IPR000157
1-137 TIR
Toll/interleukin-1 receptor homology (TIR) domain

FRGKDTRNNFTSHLYSNLKQRGIDVYMDDRELERGKTIEPALWKAIEESRFSVIIFSRDYASSPWCLDELVKIVQCMKETGHTVLPVFYDVDPSEVAEQKGQYEKAFVEHEQNFKENLEKVQIWKDCLSTVTNLSGW

HMMPanther: PTHR11017:SF20
20-939 PTHR11017:SF20,SUBFAMILY NOT NAMED

QRGIDVYMDDRELERGKTIEPALWKAIEESRFSVIIFSRDYASSPWCLDELVKIVQCMKETGHTVLPVFYDVDPSEVAEQKGQYEKAFVEHEQNFKENLEKVQIWKDCLSTVTNLSGWDVRNRNESESIKIIVEYISYKLSVTLPTISKKLVGIDSRVKVLNGYIGEEVGKAIFIGICGMGGIGKTTVARVLYDKIRWQFEGSYFLANVREVFAEKGGPRRLQEQLLSEILMECASLKDSYRGIEMIKRRLRLKKILLILDDVDDKKQLEFLAAEPGWFGPGSRIIITSRDTNVFTGNDDTKIYEAEKLNDDDALMLFNQKAFKNDQPTEDFVKLSKQVVGYANGLPLALEVIDIACFLKGFEKDRIIRILDSCGFHAHIGTQVLIERSLISVYRDQVWMHDLLQIMGKEIVRSESSEEPGRRSRLWTFEDVRLALMDNTGKEKIEAIFLDMPEIKEAQWNMEAFSKMSRLRLLKIDNVQLSEGPEDLSNKLRFLEWHSYPSKSLPAGLQVDELVELHMANSSIEQLWYGCKSAVNLKIINLSNSLNLSKTPDLTGIPNLESLILEGCTSLSKVHPSLAHHKKLQYMNLVNCKSIRILPNNLEMESLKVFTLDGCSKLEKFPDIVGNMNCLMELRLDGTGVEELSSSIHHLISLEVLSMNNCKNLESIPSSIGCLKSLKKLDLSGCSELKNLEKVESSEEFDASGTSIRQPPAPIFLLKNLKVLSFDGCKRIAVSLTDQRLPSLSGLCSLEVLDLCACNLREGALPEDIGCLSSLKSLDLSRNNFVSLPRSVNQLSGLEMLVLEDCRMLESLPEVPSKVQTVNLNGCTSLKEIPDPIKLSSSKISEFLCLNCWELYEHNGQDSMGLTMLERYLQGLSNPRPGFGIAVPGNEIPGWFNHQSKGSSISVQVPSWSMGFVACV

HMMPanther: PTHR11017
20-939 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

QRGIDVYMDDRELERGKTIEPALWKAIEESRFSVIIFSRDYASSPWCLDELVKIVQCMKETGHTVLPVFYDVDPSEVAEQKGQYEKAFVEHEQNFKENLEKVQIWKDCLSTVTNLSGWDVRNRNESESIKIIVEYISYKLSVTLPTISKKLVGIDSRVKVLNGYIGEEVGKAIFIGICGMGGIGKTTVARVLYDKIRWQFEGSYFLANVREVFAEKGGPRRLQEQLLSEILMECASLKDSYRGIEMIKRRLRLKKILLILDDVDDKKQLEFLAAEPGWFGPGSRIIITSRDTNVFTGNDDTKIYEAEKLNDDDALMLFNQKAFKNDQPTEDFVKLSKQVVGYANGLPLALEVIDIACFLKGFEKDRIIRILDSCGFHAHIGTQVLIERSLISVYRDQVWMHDLLQIMGKEIVRSESSEEPGRRSRLWTFEDVRLALMDNTGKEKIEAIFLDMPEIKEAQWNMEAFSKMSRLRLLKIDNVQLSEGPEDLSNKLRFLEWHSYPSKSLPAGLQVDELVELHMANSSIEQLWYGCKSAVNLKIINLSNSLNLSKTPDLTGIPNLESLILEGCTSLSKVHPSLAHHKKLQYMNLVNCKSIRILPNNLEMESLKVFTLDGCSKLEKFPDIVGNMNCLMELRLDGTGVEELSSSIHHLISLEVLSMNNCKNLESIPSSIGCLKSLKKLDLSGCSELKNLEKVESSEEFDASGTSIRQPPAPIFLLKNLKVLSFDGCKRIAVSLTDQRLPSLSGLCSLEVLDLCACNLREGALPEDIGCLSSLKSLDLSRNNFVSLPRSVNQLSGLEMLVLEDCRMLESLPEVPSKVQTVNLNGCTSLKEIPDPIKLSSSKISEFLCLNCWELYEHNGQDSMGLTMLERYLQGLSNPRPGFGIAVPGNEIPGWFNHQSKGSSISVQVPSWSMGFVACV

superfamily: SSF52540
153-399 SSF52540

EYISYKLSVTLPTISKKLVGIDSRVKVLNGYIGEEVGKAIFIGICGMGGIGKTTVARVLYDKIRWQFEGSYFLANVREVFAEKGGPRRLQEQLLSEILMECASLKDSYRGIEMIKRRLRLKKILLILDDVDDKKQLEFLAAEPGWFGPGSRIIITSRDTNVFTGNDDTKIYEAEKLNDDDALMLFNQKAFKNDQPTEDFVKLSKQVVGYANGLPLALEVIDIACFLKGFEKDRIIRILDSCGFHAHI

Gene3D: G3DSA:3.40.50.300
166-285 G3DSA:3.40.50.300

ISKKLVGIDSRVKVLNGYIGEEVGKAIFIGICGMGGIGKTTVARVLYDKIRWQFEGSYFLANVREVFAEKGGPRRLQEQLLSEILMECASLKDSYRGIEMIKRRLRLKKILLILDDVDDK

HMMPfam: PF00931
IPR002182
189-380 NB-ARC,NBS
NB-ARC

GKAIFIGICGMGGIGKTTVARVLYDKIRWQFEGSYFLANVREVFAEKGGPRRLQEQLLSEILMECASLKDSYRGIEMIKRRLRLKKILLILDDVDDKKQLEFLAAEPGWFGPGSRIIITSRDTNVFTGNDDTKIYEAEKLNDDDALMLFNQKAFKNDQPTEDFVKLSKQVVGYANGLPLALEVIDIACFLKG

FPrintScan: PR00364
IPR000767
193-208 DISEASERSIST
Disease resistance protein

FIGICGMGGIGKTTVA

FPrintScan: PR00364
IPR000767
269-283 DISEASERSIST
Disease resistance protein

RLRLKKILLILDDVD

FPrintScan: PR00364
IPR000767
362-376 DISEASERSIST
Disease resistance protein

ANGLPLALEVIDIAC

superfamily: SSF52058
430-865 SSF52058,LRR

IVRSESSEEPGRRSRLWTFEDVRLALMDNTGKEKIEAIFLDMPEIKEAQWNMEAFSKMSRLRLLKIDNVQLSEGPEDLSNKLRFLEWHSYPSKSLPAGLQVDELVELHMANSSIEQLWYGCKSAVNLKIINLSNSLNLSKTPDLTGIPNLESLILEGCTSLSKVHPSLAHHKKLQYMNLVNCKSIRILPNNLEMESLKVFTLDGCSKLEKFPDIVGNMNCLMELRLDGTGVEELSSSIHHLISLEVLSMNNCKNLESIPSSIGCLKSLKKLDLSGCSELKNLEKVESSEEFDASGTSIRQPPAPIFLLKNLKVLSFDGCKRIAVSLTDQRLPSLSGLCSLEVLDLCACNLREGALPEDIGCLSSLKSLDLSRNNFVSLPRSVNQLSGLEMLVLEDCRMLESLPEVPSKVQTVNLNGCTSLKEIPDPIKLSSSKISE

Gene3D: G3DSA:3.80.10.10
481-600 G3DSA:3.80.10.10

MEAFSKMSRLRLLKIDNVQLSEGPEDLSNKLRFLEWHSYPSKSLPAGLQVDELVELHMANSSIEQLWYGCKSAVNLKIINLSNSLNLSKTPDLTGIPNLESLILEGCTSLSKVHPSLAHH

ProfileScan: PS51450
IPR001611
555-577 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKIINLSNSLNLSKTPDLTGIP

Gene3D: G3DSA:3.80.10.10
601-741 G3DSA:3.80.10.10

KKLQYMNLVNCKSIRILPNNLEMESLKVFTLDGCSKLEKFPDIVGNMNCLMELRLDGTGVEELSSSIHHLISLEVLSMNNCKNLESIPSSIGCLKSLKKLDLSGCSELKNLEKVESSEEFDASGTSIRQPPAPIFLLKNLK

HMMPfam: PF00560
IPR001611
672-694 LRR_1
Leucine-rich repeat

SLEVLSMNNCKNLESIPSSIGCL

ProfileScan: PS51450
IPR001611
672-694 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEVLSMNNCKNLESIPSSIGCL

FPrintScan: PR00364
IPR000767
692-708 DISEASERSIST
Disease resistance protein

GCLKSLKKLDLSGCSEL

ProfileScan: PS51450
IPR001611
696-718 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKKLDLSGCSELKNLEKVESSE

Gene3D: G3DSA:3.80.10.10
742-864 G3DSA:3.80.10.10

VLSFDGCKRIAVSLTDQRLPSLSGLCSLEVLDLCACNLREGALPEDIGCLSSLKSLDLSRNNFVSLPRSVNQLSGLEMLVLEDCRMLESLPEVPSKVQTVNLNGCTSLKEIPDPIKLSSSKIS

HMMSmart: SM00369
IPR003591
791-814 LRR_TYP
Leucine-rich repeat, typical subtype

LSSLKSLDLSRNNFVSLPRSVNQL

HMMPfam: PF00560
IPR001611
793-810 LRR_1
Leucine-rich repeat

SLKSLDLSRNNFVSLPRS

ProfileScan: PS51450
IPR001611
793-814 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKSLDLSRNNFVSLPRSVNQL

ProfileScan: PS50104
IPR000157
1046-1200 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SSYKASLAFSWSYHQWKANVFPVIRVADTSNSFSYLQSDLALRFIMSVEKEPEKIMAIRSRLFEAIEESGLSIIIFARDCVSLPWCFEELVKIVGFMDEMRSDTVFPVSYDVEQSKIDDQTESYTIVFDKNEENLRENEEKVQRWTNILSEVEIS

HMMSmart: SM00255
IPR000157
1062-1200 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KANVFPVIRVADTSNSFSYLQSDLALRFIMSVEKEPEKIMAIRSRLFEAIEESGLSIIIFARDCVSLPWCFEELVKIVGFMDEMRSDTVFPVSYDVEQSKIDDQTESYTIVFDKNEENLRENEEKVQRWTNILSEVEIS

Gene3D: G3DSA:3.40.50.10140
1101-1191 G3DSA:3.40.50.10140

MAIRSRLFEAIEESGLSIIIFARDCVSLPWCFEELVKIVGFMDEMRSDTVFPVSYDVEQSKIDDQTESYTIVFDKNEENLRENEEKVQRWT

superfamily: SSF52200
IPR000157
1101-1203 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MAIRSRLFEAIEESGLSIIIFARDCVSLPWCFEELVKIVGFMDEMRSDTVFPVSYDVEQSKIDDQTESYTIVFDKNEENLRENEEKVQRWTNILSEVEISSGS

HMMPfam: PF01582
IPR000157
1103-1195 TIR
Toll/interleukin-1 receptor homology (TIR) domain

IRSRLFEAIEESGLSIIIFARDCVSLPWCFEELVKIVGFMDEMRSDTVFPVSYDVEQSKIDDQTESYTIVFDKNEENLRENEEKVQRWTNILS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox