PRGDB00047413 (TIR-NBS-LRR type disease resistance protein)

From PRG Wiki
Jump to: navigation, search
TIR-NBS-LRR type disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 105922481 (DQ513205)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, TIR, Others
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa clone 1458657 TIR-NBS-LRR type disease resistance protein mRNA, complete cds.

DNA Sequence

ATGGCTGCTTCTTATTCACGTACTACCACTCGGTGGAAATATGATGTCTTCCTCAGTTTCAGAGGTGAAGACACCCGGAAGAGTTTTACTGACCATCTTTATACTGCCTTGTGTCACAGAGGAGTCATCACTTTTAGAGATGATCAAGAACTTGAGAGAGGGAATGAAATTTCCCGTGAACTTCTTCAAGCAATACAAGATTCAAGGTTTTCAGTGATAGTTTTCTCAAGAAACTATACTTCTTCCACATGGTGCTTGAACGAACTAGTAAAAATTGTGGAATGCATGAAACAAGGTAGACAAACAGTTATTCCAGTTTTCTATGATGTTGATCCTTCTGAAGTAAGGAATCAGACAGGGAGACTTCAACAGGCCTTTGCTGATCATGAAGAGGTTTTCAAAGACAACATTGAGAAGGTGCAGACCTGGAGGATTGCGATGAAACTAGTGGCCAATCTTTCTGGATGGGATTTGCAGGATAGGCACGAGTCAGAGTTTATTCAAGGCATTGTTGAAGAGATAGTATGCAAGTTGAGAAAATCAAGTTACAGCATGTCATGGGTAACCGAGAACTTAGTTGGAATGGATTGGCGTTTGGAGGAAATGAGTTTATATTTAGGAGTAGAGCAGCTGAATGATGTTCGCGTTATAGGGATCTGTGGGATGGGTGGAATAGGTAAGACGACCATTGCTAGAGCTGTCTATGAGAAGATGCTGGGTCATTTTGAAGGCAGCAGCTTTCTTGCAAATGTTAGAGAAGTTGAGGAGAAACATGGTTTAGTTCGCTTACAGGAACAACTTCTTTCAGACACGTTGATGGATAGAAGGACCAAAATCTCTGATGTTCATAGAGGAATGAATGAAATAAGGGTTAGGCTGCGTTCTAGAATGGTTCTTGTTGTTCTTGATGATGTTGATCAATTGGTCCAATTAGAATCTTTAGTTGGAGATCGTAATTGGTTTGACAATGGAAGTAGAGTCATAATAACCACAAGAGATGAACTTCTTCTGAAACAATTTGGAGTTGATAAAATATATAGAGTTGCAAGTTTAAATAACATTGAAGCCGTTCAACTCTTTTGTCTGAAAGCCTTCAGAAGTTATTGTCCCCCGGAAGATTATGTGCTTCAGACCATCCAAGTTGTAAAGTATGCAGATGGCCTTCCATTAGCTCTCCATGTTTTGGGTTCATTTTTTTCTGGGATCAGATCTGTAGAATTGTGGAACCATTCATTGAAAAGACTGAAAGATATCCCAGATAAAGGAATTCTAGATAAACTTAAAATAAGTTTTGATGGACTTAACGAAGTAGAGAAGAAAATATTTCTAGATATTGCTTGTTTTTTCAACGGGTGGGAAGAAGATTGTGTGACAAAATTAATGGAAAGTTCTGGTTTCTATCCACAGATTGGAATAAGGATTCTCGTAGAAAAATTTCTCATAAATATTTCAGATAACAGAGTATGGATGCATGACTTGCTTCAAGAAATGGGTCGACAAATTGTCAAGAGAGAGTCTCATGAAGAACCTGGAAAACGCACTAGGTTGTGGCTCTGTGAGGATGTCATTCACGTTTTGCTAAATAATACGGTAAATAACTTACTGTTACAACCACAATTCTATGTATCAGATTTTGAGTTTCCCTTTTCCTGTTCATCATTCCTATTTATTAACTTTACTGTTCAGGGAACCGACAAAGTTGAAGGCATCGTCCTGAATTCAAATGACGAAGTAGATGGACTATACTTAAGTGCTGAATCAATAATGAAGATGAAAAGGTTAAGAATTCTCAAACTCCAAAATATAAACCTTTCCCAGGAAATTAAATATCTCTCCAATGAGTTGAGATATCTTGAATGGTGCCGATATCCTTTCAAATCATTGCCATCAACTTTTCAACCGGATAAACTTGTTGAGCTCCACATGCGTCATAGCAGCATTAAACAATTATGGGAGGGACCTTTAAAGTTGCTTAGAGCTATTGATCTCAGACACTCCCGAAACTTAATAAAGACTCCAGACTTCAGACAAGTTCCAAATCTTGAGAAGCTGAATCTTGAGGGTTGCAGAAAACTGGTCAAGATTGACGACTCTATCGGAATTCTGAAAGGGCTTGTTTTCTTGAATTTGAAGGACTGCGTAAAGCTTGCCTGTCTTCCAACAAACATATGTGAGTTGAAGACCCTCAGAATTCTTAACTTGTATGGATGCTTCAAACTTGAAAAATTGCCTGAGATGTTGGGAAATGTAATAAATCTGGAGGAGCTTGATGTAGGCAGAACTGCTATAACACAACTGCCATCAACCTTTGGTCTCTGGAAAAAACTTAAGGTGCTATCTTTTGATGGATGCAAGGGACCAGCACCTAAATCATGGTATTCTCTCTTCTCCTTCCGGTCACTTCCAAGAAATCCTTGTCCAATTACTTTGATGCTGTCCTCTCTGTCAACGCTATACTCTTTGACAAAGCTAAATCTAAGCAACTGCAATCTCATGGAAGGAGAACTTCCTGATGATATGAGCTGCTTCCCATCATTGGAAGAATTAGACCTTATTGGAAATAACTTTGTGAGAATACCTTCAAGCATCAGCCGGCTCTCTAAACTTAAAAGCCTCAGGTTAGGCAATTGCAAGAAGCTTCAGTCACTTCCGGATCTTCCATCAAGGCTTGAATATCTCGGGGTGGACGGTTGCGCTTCGTTGGGAACTCTTCCAAATCTATTTGAAGAATGTGCCCGCTCAAAGTTTTTGTCCTTGATTTTTATGAACTGCTCCGAGTTGACTGATTATCAAGGGAATATCAGCATGGGAAGTGAAATTCCTAGTTGGTTTCACCATAAGAGCGTGGGTCATTCTTTAACAATACGGCTACTTCCTTATGAGCATTGGTCCAGCAGTAAGTGGATGGGATTAGCTGTTTGTGCATTCTTTGAAGAGCTTGATTGTGGTGATTCATGTCTTATTACATTGAACTTCGATATCAAAGGCTTCAAATCTAGGAGCTACTTTCTAGAGTACCCTGAAGGTTCAACATTTACGTCAAATCAGGTTTTCTTTATCTTCTTTCCCAGAGGCAAGTTTCCGGAACCACTTGCTGTGTCTAATACTACTTCTCAGCCCATTGAGGTGGAGTTCCGGTCATCTATTCAAGAAAGAAACACCAACAATGAGTTTCAGGTTCTTTCTGCCCGAGTCATGAATTGGGGGTTCCGCATGGTGTACGAGGAAGACACAGTGCAGTTCAACGAACCGAATACAAGTGTCGACTCTATCAATGGATTGCATTCTGAAGAGTTGAGGATATTGGATGAGAACAACTCCATCATCCCATGCAAAAATATTGAGGGCAAATGCCTCCCAGAATAA


Protein sequences

Name Description Sequence
TIR-NBS-LRR type disease resistance protein TIR-NBS-LRR type disease resistance protein [Populus trichocarpa].

MAASYSRTTTRWKYDVFLSFRGEDTRKSFTDHLYTALCHRGVITFRDDQELERGNEISRELLQAIQDSRFSVIVFSRNYTSSTWCLNELVKIVECMKQGRQTVIPVFYDVDPSEVRNQTGRLQQAFADHEEVFKDNIEKVQTWRIAMKLVANLSGWDLQDRHESEFIQGIVEEIVCKLRKSSYSMSWVTENLVGMDWRLEEMSLYLGVEQLNDVRVIGICGMGGIGKTTIARAVYEKMLGHFEGSSFLANVREVEEKHGLVRLQEQLLSDTLMDRRTKISDVHRGMNEIRVRLRSRMVLVVLDDVDQLVQLESLVGDRNWFDNGSRVIITTRDELLLKQFGVDKIYRVASLNNIEAVQLFCLKAFRSYCPPEDYVLQTIQVVKYADGLPLALHVLGSFFSGIRSVELWNHSLKRLKDIPDKGILDKLKISFDGLNEVEKKIFLDIACFFNGWEEDCVTKLMESSGFYPQIGIRILVEKFLINISDNRVWMHDLLQEMGRQIVKRESHEEPGKRTRLWLCEDVIHVLLNNTVNNLLLQPQFYVSDFEFPFSCSSFLFINFTVQGTDKVEGIVLNSNDEVDGLYLSAESIMKMKRLRILKLQNINLSQEIKYLSNELRYLEWCRYPFKSLPSTFQPDKLVELHMRHSSIKQLWEGPLKLLRAIDLRHSRNLIKTPDFRQVPNLEKLNLEGCRKLVKIDDSIGILKGLVFLNLKDCVKLACLPTNICELKTLRILNLYGCFKLEKLPEMLGNVINLEELDVGRTAITQLPSTFGLWKKLKVLSFDGCKGPAPKSWYSLFSFRSLPRNPCPITLMLSSLSTLYSLTKLNLSNCNLMEGELPDDMSCFPSLEELDLIGNNFVRIPSSISRLSKLKSLRLGNCKKLQSLPDLPSRLEYLGVDGCASLGTLPNLFEECARSKFLSLIFMNCSELTDYQGNISMGSEIPSWFHHKSVGHSLTIRLLPYEHWSSSKWMGLAVCAFFEELDCGDSCLITLNFDIKGFKSRSYFLEYPEGSTFTSNQVFFIFFPRGKFPEPLAVSNTTSQPIEVEFRSSIQERNTNNEFQVLSARVMNWGFRMVYEEDTVQFNEPNTSVDSINGLHSEELRILDENNSIIPCKNIEGKCLPE

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
2-156 TIR
Toll/interleukin-1 receptor homology (TIR) domain

AASYSRTTTRWKYDVFLSFRGEDTRKSFTDHLYTALCHRGVITFRDDQELERGNEISRELLQAIQDSRFSVIVFSRNYTSSTWCLNELVKIVECMKQGRQTVIPVFYDVDPSEVRNQTGRLQQAFADHEEVFKDNIEKVQTWRIAMKLVANLSGW

Gene3D: G3DSA:3.40.50.10140
10-140 G3DSA:3.40.50.10140

TRWKYDVFLSFRGEDTRKSFTDHLYTALCHRGVITFRDDQELERGNEISRELLQAIQDSRFSVIVFSRNYTSSTWCLNELVKIVECMKQGRQTVIPVFYDVDPSEVRNQTGRLQQAFADHEEVFKDNIEKV

ProfileScan: PS50104
IPR000157
12-153 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WKYDVFLSFRGEDTRKSFTDHLYTALCHRGVITFRDDQELERGNEISRELLQAIQDSRFSVIVFSRNYTSSTWCLNELVKIVECMKQGRQTVIPVFYDVDPSEVRNQTGRLQQAFADHEEVFKDNIEKVQTWRIAMKLVANL

HMMSmart: SM00255
IPR000157
13-153 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KYDVFLSFRGEDTRKSFTDHLYTALCHRGVITFRDDQELERGNEISRELLQAIQDSRFSVIVFSRNYTSSTWCLNELVKIVECMKQGRQTVIPVFYDVDPSEVRNQTGRLQQAFADHEEVFKDNIEKVQTWRIAMKLVANL

HMMPfam: PF01582
IPR000157
16-147 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGEDTRKSFTDHLYTALCHRGVITFRDDQELERGNEISRELLQAIQDSRFSVIVFSRNYTSSTWCLNELVKIVECMKQGRQTVIPVFYDVDPSEVRNQTGRLQQAFADHEEVFKDNIEKVQTWRIAM

HMMPanther: PTHR11017:SF20
42-1017 PTHR11017:SF20,SUBFAMILY NOT NAMED

VITFRDDQELERGNEISRELLQAIQDSRFSVIVFSRNYTSSTWCLNELVKIVECMKQGRQTVIPVFYDVDPSEVRNQTGRLQQAFADHEEVFKDNIEKVQTWRIAMKLVANLSGWDLQDRHESEFIQGIVEEIVCKLRKSSYSMSWVTENLVGMDWRLEEMSLYLGVEQLNDVRVIGICGMGGIGKTTIARAVYEKMLGHFEGSSFLANVREVEEKHGLVRLQEQLLSDTLMDRRTKISDVHRGMNEIRVRLRSRMVLVVLDDVDQLVQLESLVGDRNWFDNGSRVIITTRDELLLKQFGVDKIYRVASLNNIEAVQLFCLKAFRSYCPPEDYVLQTIQVVKYADGLPLALHVLGSFFSGIRSVELWNHSLKRLKDIPDKGILDKLKISFDGLNEVEKKIFLDIACFFNGWEEDCVTKLMESSGFYPQIGIRILVEKFLINISDNRVWMHDLLQEMGRQIVKRESHEEPGKRTRLWLCEDVIHVLLNNTVNNLLLQPQFYVSDFEFPFSCSSFLFINFTVQGTDKVEGIVLNSNDEVDGLYLSAESIMKMKRLRILKLQNINLSQEIKYLSNELRYLEWCRYPFKSLPSTFQPDKLVELHMRHSSIKQLWEGPLKLLRAIDLRHSRNLIKTPDFRQVPNLEKLNLEGCRKLVKIDDSIGILKGLVFLNLKDCVKLACLPTNICELKTLRILNLYGCFKLEKLPEMLGNVINLEELDVGRTAITQLPSTFGLWKKLKVLSFDGCKGPAPKSWYSLFSFRSLPRNPCPITLMLSSLSTLYSLTKLNLSNCNLMEGELPDDMSCFPSLEELDLIGNNFVRIPSSISRLSKLKSLRLGNCKKLQSLPDLPSRLEYLGVDGCASLGTLPNLFEECARSKFLSLIFMNCSELTDYQGNISMGSEIPSWFHHKSVGHSLTIRLLPYEHWSSSKWMGLAVCAFFEELDCGDSCLITLNFDIKGFKSRSYFLEYPEGSTFTSNQV

HMMPanther: PTHR11017
42-1017 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VITFRDDQELERGNEISRELLQAIQDSRFSVIVFSRNYTSSTWCLNELVKIVECMKQGRQTVIPVFYDVDPSEVRNQTGRLQQAFADHEEVFKDNIEKVQTWRIAMKLVANLSGWDLQDRHESEFIQGIVEEIVCKLRKSSYSMSWVTENLVGMDWRLEEMSLYLGVEQLNDVRVIGICGMGGIGKTTIARAVYEKMLGHFEGSSFLANVREVEEKHGLVRLQEQLLSDTLMDRRTKISDVHRGMNEIRVRLRSRMVLVVLDDVDQLVQLESLVGDRNWFDNGSRVIITTRDELLLKQFGVDKIYRVASLNNIEAVQLFCLKAFRSYCPPEDYVLQTIQVVKYADGLPLALHVLGSFFSGIRSVELWNHSLKRLKDIPDKGILDKLKISFDGLNEVEKKIFLDIACFFNGWEEDCVTKLMESSGFYPQIGIRILVEKFLINISDNRVWMHDLLQEMGRQIVKRESHEEPGKRTRLWLCEDVIHVLLNNTVNNLLLQPQFYVSDFEFPFSCSSFLFINFTVQGTDKVEGIVLNSNDEVDGLYLSAESIMKMKRLRILKLQNINLSQEIKYLSNELRYLEWCRYPFKSLPSTFQPDKLVELHMRHSSIKQLWEGPLKLLRAIDLRHSRNLIKTPDFRQVPNLEKLNLEGCRKLVKIDDSIGILKGLVFLNLKDCVKLACLPTNICELKTLRILNLYGCFKLEKLPEMLGNVINLEELDVGRTAITQLPSTFGLWKKLKVLSFDGCKGPAPKSWYSLFSFRSLPRNPCPITLMLSSLSTLYSLTKLNLSNCNLMEGELPDDMSCFPSLEELDLIGNNFVRIPSSISRLSKLKSLRLGNCKKLQSLPDLPSRLEYLGVDGCASLGTLPNLFEECARSKFLSLIFMNCSELTDYQGNISMGSEIPSWFHHKSVGHSLTIRLLPYEHWSSSKWMGLAVCAFFEELDCGDSCLITLNFDIKGFKSRSYFLEYPEGSTFTSNQV

superfamily: SSF52540
175-423 SSF52540

VCKLRKSSYSMSWVTENLVGMDWRLEEMSLYLGVEQLNDVRVIGICGMGGIGKTTIARAVYEKMLGHFEGSSFLANVREVEEKHGLVRLQEQLLSDTLMDRRTKISDVHRGMNEIRVRLRSRMVLVVLDDVDQLVQLESLVGDRNWFDNGSRVIITTRDELLLKQFGVDKIYRVASLNNIEAVQLFCLKAFRSYCPPEDYVLQTIQVVKYADGLPLALHVLGSFFSGIRSVELWNHSLKRLKDIPDKGI

Gene3D: G3DSA:3.40.50.300
190-341 G3DSA:3.40.50.300

ENLVGMDWRLEEMSLYLGVEQLNDVRVIGICGMGGIGKTTIARAVYEKMLGHFEGSSFLANVREVEEKHGLVRLQEQLLSDTLMDRRTKISDVHRGMNEIRVRLRSRMVLVVLDDVDQLVQLESLVGDRNWFDNGSRVIITTRDELLLKQFG

HMMPfam: PF00931
IPR002182
212-469 NB-ARC,NBS
NB-ARC

NDVRVIGICGMGGIGKTTIARAVYEKMLGHFEGSSFLANVREVEEKHGLVRLQEQLLSDTLMDRRTKISDVHRGMNEIRVRLRSRMVLVVLDDVDQLVQLESLVGDRNWFDNGSRVIITTRDELLLKQFGVDKIYRVASLNNIEAVQLFCLKAFRSYCPPEDYVLQTIQVVKYADGLPLALHVLGSFFSGIRSVELWNHSLKRLKDIPDKGILDKLKISFDGLNEVEKKIFLDIACFFNGWEEDCVTKLMESSGFYPQ

FPrintScan: PR00364
IPR000767
216-231 DISEASERSIST
Disease resistance protein

VIGICGMGGIGKTTIA

FPrintScan: PR00364
IPR000767
292-306 DISEASERSIST
Disease resistance protein

RLRSRMVLVVLDDVD

FPrintScan: PR00364
IPR000767
385-399 DISEASERSIST
Disease resistance protein

ADGLPLALHVLGSFF

superfamily: SSF46785
421-527 SSF46785

KGILDKLKISFDGLNEVEKKIFLDIACFFNGWEEDCVTKLMESSGFYPQIGIRILVEKFLINISDNRVWMHDLLQEMGRQIVKRESHEEPGKRTRLWLCEDVIHVLL

superfamily: SSF52058
555-929 SSF52058,LRR

LFINFTVQGTDKVEGIVLNSNDEVDGLYLSAESIMKMKRLRILKLQNINLSQEIKYLSNELRYLEWCRYPFKSLPSTFQPDKLVELHMRHSSIKQLWEGPLKLLRAIDLRHSRNLIKTPDFRQVPNLEKLNLEGCRKLVKIDDSIGILKGLVFLNLKDCVKLACLPTNICELKTLRILNLYGCFKLEKLPEMLGNVINLEELDVGRTAITQLPSTFGLWKKLKVLSFDGCKGPAPKSWYSLFSFRSLPRNPCPITLMLSSLSTLYSLTKLNLSNCNLMEGELPDDMSCFPSLEELDLIGNNFVRIPSSISRLSKLKSLRLGNCKKLQSLPDLPSRLEYLGVDGCASLGTLPNLFEECARSKFLSLIFMNCSELTD

Gene3D: G3DSA:3.80.10.10
583-785 G3DSA:3.80.10.10

LSAESIMKMKRLRILKLQNINLSQEIKYLSNELRYLEWCRYPFKSLPSTFQPDKLVELHMRHSSIKQLWEGPLKLLRAIDLRHSRNLIKTPDFRQVPNLEKLNLEGCRKLVKIDDSIGILKGLVFLNLKDCVKLACLPTNICELKTLRILNLYGCFKLEKLPEMLGNVINLEELDVGRTAITQLPSTFGLWKKLKVLSFDGCK

HMMPfam: PF07725
IPR011713
636-653 LRR_3
Leucine-rich repeat 3

KLVELHMRHSSIKQLWEG

Gene3D: G3DSA:3.80.10.10
809-922 G3DSA:3.80.10.10

TLMLSSLSTLYSLTKLNLSNCNLMEGELPDDMSCFPSLEELDLIGNNFVRIPSSISRLSKLKSLRLGNCKKLQSLPDLPSRLEYLGVDGCASLGTLPNLFEECARSKFLSLIFM

HMMPfam: PF00560
IPR001611
820-839 LRR_1
Leucine-rich repeat

SLTKLNLSNCNLMEGELPDD

HMMPfam: PF12799
844-887 LRR_4,Leucine Rich repeats (2 copies)

PSLEELDLIGNNFVRIPSSISRLSKLKSLRLGNCKKLQSLPDLP

FPrintScan: PR00364
IPR000767
864-880 DISEASERSIST
Disease resistance protein

SRLSKLKSLRLGNCKKL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox