PRGDB00047416 (TIR-NBS-LRR type disease resistance protein)

From PRG Wiki
Jump to: navigation, search
TIR-NBS-LRR type disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 105922414 (DQ513201)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa clone 2775405 TIR-NBS-LRR type disease resistance protein mRNA, complete cds.

DNA Sequence

ATGCAGAAAGCAGCCTCATCTTCTTATTCTCCTCCCCAATGGAAGTATGATGTCTTCCTTAGTTTTAGAGGCAAAGACACACGGAATAACTTTACTAGCCATCTATATTCTAATTTGGAACAAAGAGGCATCGATGTATACATGGATGATAGCGGGCTAGAGAGAGGAAAGACCATCGAACCTGCTCTCTGGCAGGCCATCGAAGATTCAAGATTTTCAATCGTTGTGTTTTCAAGAGATTACGCGTCTTCATCATGGTGCTTAGATGAGCTTGTCAAGATTGTTCAGTGCATGAAAGAGATGGGGCACACTGTTCTACCAGTTTTTTATGATGTGGATCCATCAGAGGTAGCGGATCAGACAGGGGATTATAAGAAGGCGTTCATTGAGCATAAGGAAAAGCACTCGGGAAATCTGGACAAGTGGCCAATCTATCTGGTTGGGATGTACGGAACAGGGATATGTGGAATGGGTGGCATGGGAAAGACAACTGTTGCAAGAGTCATGTATGATAGGATTCGTTGGCAATTCCATGGCAGCTGCTTCTTAGCAAATGTGAGAGAAGTTTTTGCAGAGAAAGATGGACTGTGTCGTTTACAGGAACAACTTCTTTTGGAAATCTCAATGGAGCTTCCCACTGCACGGGATTCTTCAAGAAGGATTGATTTGATAAAGCGCAGGCTGCGGCTTAAAAAGGTTCTTCTTATTCTGGATGATGTAGATGATGAAGAACAATTACAGATGTTGGCTGCAGAGCATGGATCGTTTGGTCCAGGGAGCCGGATTATCATAACGAGCAGAAATAAACATGTGCTGGATAGCCATGGTGTTACTAGAATATACGAGGCTGAGAAATTAAATGATAAAGATGCTCTTATGTTATTTAGCTGGAAAGCTTTCAAAAGAGACCAGCCTGCCGAAGATTTATCGGAACTATCCAAGCAAGTTGTGGGTTATGCTAATGGCCTTCCACTAGCTCTTGAAGTCATAGAAAAATATTAA


Protein sequences

Name Description Sequence
TIR-NBS-LRR type disease resistance protein TIR-NBS-LRR type disease resistance protein [Populus trichocarpa].

MQKAASSSYSPPQWKYDVFLSFRGKDTRNNFTSHLYSNLEQRGIDVYMDDSGLERGKTIEPALWQAIEDSRFSIVVFSRDYASSSWCLDELVKIVQCMKEMGHTVLPVFYDVDPSEVADQTGDYKKAFIEHKEKHSGNLDKWPIYLVGMYGTGICGMGGMGKTTVARVMYDRIRWQFHGSCFLANVREVFAEKDGLCRLQEQLLLEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGSFGPGSRIIITSRNKHVLDSHGVTRIYEAEKLNDKDALMLFSWKAFKRDQPAEDLSELSKQVVGYANGLPLALEVIEKY

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
4-146 TIR
Toll/interleukin-1 receptor homology (TIR) domain

AASSSYSPPQWKYDVFLSFRGKDTRNNFTSHLYSNLEQRGIDVYMDDSGLERGKTIEPALWQAIEDSRFSIVVFSRDYASSSWCLDELVKIVQCMKEMGHTVLPVFYDVDPSEVADQTGDYKKAFIEHKEKHSGNLDKWPIYL

Gene3D: G3DSA:3.40.50.10140
13-132 G3DSA:3.40.50.10140

QWKYDVFLSFRGKDTRNNFTSHLYSNLEQRGIDVYMDDSGLERGKTIEPALWQAIEDSRFSIVVFSRDYASSSWCLDELVKIVQCMKEMGHTVLPVFYDVDPSEVADQTGDYKKAFIEHK

ProfileScan: PS50104
IPR000157
14-142 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WKYDVFLSFRGKDTRNNFTSHLYSNLEQRGIDVYMDDSGLERGKTIEPALWQAIEDSRFSIVVFSRDYASSSWCLDELVKIVQCMKEMGHTVLPVFYDVDPSEVADQTGDYKKAFIEHKEKHSGNLDKW

HMMSmart: SM00255
IPR000157
15-152 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KYDVFLSFRGKDTRNNFTSHLYSNLEQRGIDVYMDDSGLERGKTIEPALWQAIEDSRFSIVVFSRDYASSSWCLDELVKIVQCMKEMGHTVLPVFYDVDPSEVADQTGDYKKAFIEHKEKHSGNLDKWPIYLVGMYGT

HMMPfam: PF01582
IPR000157
18-137 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGKDTRNNFTSHLYSNLEQRGIDVYMDDSGLERGKTIEPALWQAIEDSRFSIVVFSRDYASSSWCLDELVKIVQCMKEMGHTVLPVFYDVDPSEVADQTGDYKKAFIEHKEKHSG

FPrintScan: PR00364
IPR000767
151-166 DISEASERSIST
Disease resistance protein

GTGICGMGGMGKTTVA

Gene3D: G3DSA:3.40.50.300
152-275 G3DSA:3.40.50.300

TGICGMGGMGKTTVARVMYDRIRWQFHGSCFLANVREVFAEKDGLCRLQEQLLLEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGSFGPGSRIIITSRNKHVLDSH

HMMPanther: PTHR11017:SF20
153-330 PTHR11017:SF20,SUBFAMILY NOT NAMED

GICGMGGMGKTTVARVMYDRIRWQFHGSCFLANVREVFAEKDGLCRLQEQLLLEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGSFGPGSRIIITSRNKHVLDSHGVTRIYEAEKLNDKDALMLFSWKAFKRDQPAEDLSELSKQVVGYANGLPLALEVI

superfamily: SSF52540
153-332 SSF52540

GICGMGGMGKTTVARVMYDRIRWQFHGSCFLANVREVFAEKDGLCRLQEQLLLEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGSFGPGSRIIITSRNKHVLDSHGVTRIYEAEKLNDKDALMLFSWKAFKRDQPAEDLSELSKQVVGYANGLPLALEVIEK

HMMPanther: PTHR11017
153-330 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GICGMGGMGKTTVARVMYDRIRWQFHGSCFLANVREVFAEKDGLCRLQEQLLLEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGSFGPGSRIIITSRNKHVLDSHGVTRIYEAEKLNDKDALMLFSWKAFKRDQPAEDLSELSKQVVGYANGLPLALEVI

HMMPfam: PF00931
IPR002182
153-330 NB-ARC,NBS
NB-ARC

GICGMGGMGKTTVARVMYDRIRWQFHGSCFLANVREVFAEKDGLCRLQEQLLLEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGSFGPGSRIIITSRNKHVLDSHGVTRIYEAEKLNDKDALMLFSWKAFKRDQPAEDLSELSKQVVGYANGLPLALEVI

FPrintScan: PR00364
IPR000767
227-241 DISEASERSIST
Disease resistance protein

RLRLKKVLLILDDVD

FPrintScan: PR00364
IPR000767
320-333 DISEASERSIST
Disease resistance protein

ANGLPLALEVIEKY






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox