PRGDB00047417 (TIR-NBS-LRR type disease resistance protein)

From PRG Wiki
Jump to: navigation, search
TIR-NBS-LRR type disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 105922394 (DQ513200)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, LRR, TIR, Others
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa clone 205099 TIR-NBS-LRR type disease resistance protein mRNA, complete cds.

DNA Sequence

ATGCCGCTGATGGTTGCCAACATAAAAAAAGTTGTGAGTTTTTGTGGACACGTTCGGCCTCGAACATTGAGGTTGAGGCAGTGTAAGATCCGTAAGAAAATCATTGGAAACTTACCACTACGAGTTCTTGACCTAAAGGAACCGGAAAAAATTCGAAGTCATTGGAATAAAAAAAAGTTGAAGATCCGTAAGAAAATCATTGGAAACTTACCAGTACGAGTTCTTGACCTCAAGAAACCGGAAAAAATTCGAAGTCATTGGAATAAAAAGAAAGAAAAGGGCTTTGGAAGTTGTTTTAGAGGCAAAGACACCCGGGACAACTTTACTAGTCATCTATATTCTAATCTGAAACAGAGAGGCATCGATGTGTACATGGATGATAGGGAGCTCGAGAGAGGAAAGACCATCGAACCTGCTCTCTGGAAGGCCATCGAAGAATCAAGGTTTTCTGTCATTATATTTTCAAAAGATTACGCTTCTTCACCATGGTGCTTGGATGAACTTGTCAAGATTGTTCAGTGCATGAAAGAGATGGGGCAAAGTGTTCTGCCAGTTTTTTATGATGTGGATCCCTCAGAGGTAGCCGAGCAGAAAGGGCAATATGAGAAAGCCTTCGTTGAGCATGAACAAAATTTCAAGGAAAACTTGGAGAAGGTCCAGAACTGGAAAGATTGTCTCTCTACGGTGGCCAATCTATCTGGCTGGGACGTACGGAATAGGAATGAATCGGAATCAATTAAAATAATTGTTGAATACATATCGTACAAACTAAGCGTCACTCTGCCAACAATTAGCAAAAAATTAGTTGGAATAGATTCTCGTGTAGAGGTATTAAATGGCTATATACGTGAAGAAGTAGGCAAAGCAATCTTCATAGGGATCTGTGGAATGGGTGGCATAGGTAAGACGACTGTTGCACGGGTAGTATATGATAGGATTCGTTGGCAATTTGAAGGCAGCTGTTTCTTAGCAAATGTCAGAGAAGTTTTTGCTGAGAAAGATGGACGACGTCGTTTGCAGGAACAACTTCTTTCTGAAATCTTAATGGAACGTGCTTCTGTATGGGATTCTTCTAGAGGGATTGAGATGATAAAGCGGAGGTTACGACTTAAAAAGATTCTTCTTATCCTTGATGATGTAGATGACAAAGAACAACTAGAATTCTTGGCTGAGGAACCTGGATGGTTTGGTCCAGGGAGCAGAATTATCATAACTAGCAGGGACAAAAAAGTGGTAACTGGAAATAATAATAATAGAATTTATGAGGCTAAGAAATTGAATGATGATGATGCTCTTATGTTATTTAGCCAGAAAGCTTTCAAAAATGACCACCCTACTGAAGATTTTGTGGAACTATCCAAGCAAGTTGTGGGTTATGCTAATGGCCTTCCACTGGCTCTTGAAGTTATAGGTTCATTTTTGTATGACAGAAGTATCCCTGAATGGAGAGGTGCAATTAATAGAATGAATGAGATTCCTGACGGCAGAATTATTGATGTGCTTCGTGTTAGTTTTGATGGCCTCCATGAATCAGATAAGAAGATATTTTTAGACATTGCATGTTTCCTGAAGGGGTTTAAAATTGATCGAATAACAAGGATACTTCAAAGCCGTGGATTCCATGCAGGTATTGGAATACCAGTTCTTATTGAGAGATCTCTCATAAGTGTCTCTCGGGATCAAGTTTGGATGCATAATTTATTACAGATAATGGGTAAGGAAATTGTTCGTTGTGAATCCCCTGAAGAGCCTGGAAGGCGCAGTAGATTGTGGACATACGAGGATGTCTGCCTTGCACTGATGGACAACACAGGAAAAGAAAAAATAGAAGCCATATTCTTTGACATGCCTGGAATAAAAGAGGCACAATGGAACATGAAAGCCTTCTCTAAAATGAGCAGACTAAGATTGCTCAAAATCGACAACGTGCAGCTTTCTGAAGGACCTGAAAATCTTTCCAATAAGTTGCTTTTTCTTGAATGGCATTCTTACCCTTCAAAATCATTGCCAGCTGGTTTACAGGTGGATGAGCTAGTTGAACTTCACATGGCTAACAGTAATCTTGATCAATTATGGTATGGGTGTAAGAGTGCTTTTAATTTGAAAGTCATCAATCTCAGCAACTCACTACACCTGACCAAGACTCCAGATTTTACTGGAATTCCAAATCTCGAGAGTCTGATTCTTGAAGGTTGTACAAGTTTGTCTGAGGTCCATCCATCACTCGGATATCACAAGAAGCTTCAATATGTGAATCTTATGGATTGCGAAAGTGTTAGGATTCTTCCAAGCAACCTTGAAATGGAATCACTTAAAGTTTGCATTCTTGATGGATGCTCAAAACTTGAGAAGTTTCCAGATATAGTAGGAAACATGAACTGTTTGATGGTGCTTCGTTTGGATGGGACAGGTATTGAAGAACTGTCTTCATCAATTCATCATTTGATTGGCTTAGAAGTATTGAGCATGAAAACCTGTAAGAACCTTAAAAGCATTCCGAGTAGCATAGGTTGCTTGAAATCCCTTAAAAAACTTGATTTGTTTGGCTGCTCTGAATTTGAAAATATACCAGAGAATTTGGGGAAAGTTGAAAGTTTGGAGGAGTTTGATGGTTTGTCTAATCCAAGACCTGGATTTGGTATCGCTATTCCAGGAAATGAAATTCCAGGCTGGTTTAACCATCAAAGTATGGGATCTTCAATTAGTGTGCAAGTGCCTAGTTGGAGCATGGGGTTTGTTGCATGTGTTGCATTTAGTGCAAATGGTGAAAGTCCTTCTCTTTTTTGTCATTTCAAAGCCAATGGAAGAGAGAATTATCCTTCGCCGATGTGTATTAGTTGTAACTATATCCAAGTTCTGTCAGATCATATTTGGCTATTCTATCTATCTTTTGATCATCTTAAAGAGCTTAAAGAATGGAAGCATGAATCCTATAGCAACATTGAGTTGTCATTTCATTCTTTCCAGCCTGGAGTAAAGGTGAAGAACTGTGGTGTCTGTTTGTTATCTTCTGTATATATTACACCACAACCATCTTCTGCCCATTTTATTGTTACAAGCAAAGAAGCAGCTTCTTCATTTAGAGCTTCTTTAACTTTTTCTTCGTCGGACCATCAATGGAAGGCCACTGTTTTCCCTAGAATGCTGTCACTAGTCGTAACTTTAAAGTCAAATCTAGCCCAGAGATTCATTGTCCCAGTCGAGAAGGAACCAGAGAAAGTAATGGCAATTAGATCAAGACTCTTTAAGGCCATTGAAGAATCAGGGCTGTCAGTTATTATATTTGCAAGAGATTGTGCTTCTTTACATTGGTGCTTTGAAGAACTTGTCAAGATTGTCGGATTCGTGGATGAGATGAGATCGGACACTGTGTTTCCAGTTTCTTGTGATGTCGAACAATCAAAGATAGATGATCAAACAGAGAGTTACACAATTGTCTTTGATAAGAATGAAGAAAATCTCAGGGAAAACGAGGAGAAGGTGCAAAGATGGAGGAATATTCTCAATGAAGTTGAAATTTCATCTGGATCGAAAAGTTTGACTATACCTAAACTGCAGCAGCTGCTCCAGCAGCACCAGCAGCTGCAGCTGCTCGAGCATAAGCTAATGCTCGAGGAGCAGCAGCTCCAGCAGCAGTGGCAGCAGACATGGTGGCGGCAGCAGCAGCTCGACGAGGAGCTGCTCCGGCAGCAGCAGGTGCTCCAGCCGGTGCTGAGGCAGCAGCAGCGGCGGCAGCAGCAGCTCCAGCGGCGGCAGCAGCAGGGGCTACAGCAGCTGCAGCACCTGCTCCAGCAGCAGCAGCTACAGCAGCAGCTCCCTTGGTTTTGGTCAGGAATTAACTTGCTTTAG


Protein sequences

Name Description Sequence
TIR-NBS-LRR type disease resistance protein TIR-NBS-LRR type disease resistance protein [Populus trichocarpa].

MPLMVANIKKVVSFCGHVRPRTLRLRQCKIRKKIIGNLPLRVLDLKEPEKIRSHWNKKKLKIRKKIIGNLPVRVLDLKKPEKIRSHWNKKKEKGFGSCFRGKDTRDNFTSHLYSNLKQRGIDVYMDDRELERGKTIEPALWKAIEESRFSVIIFSKDYASSPWCLDELVKIVQCMKEMGQSVLPVFYDVDPSEVAEQKGQYEKAFVEHEQNFKENLEKVQNWKDCLSTVANLSGWDVRNRNESESIKIIVEYISYKLSVTLPTISKKLVGIDSRVEVLNGYIREEVGKAIFIGICGMGGIGKTTVARVVYDRIRWQFEGSCFLANVREVFAEKDGRRRLQEQLLSEILMERASVWDSSRGIEMIKRRLRLKKILLILDDVDDKEQLEFLAEEPGWFGPGSRIIITSRDKKVVTGNNNNRIYEAKKLNDDDALMLFSQKAFKNDHPTEDFVELSKQVVGYANGLPLALEVIGSFLYDRSIPEWRGAINRMNEIPDGRIIDVLRVSFDGLHESDKKIFLDIACFLKGFKIDRITRILQSRGFHAGIGIPVLIERSLISVSRDQVWMHNLLQIMGKEIVRCESPEEPGRRSRLWTYEDVCLALMDNTGKEKIEAIFFDMPGIKEAQWNMKAFSKMSRLRLLKIDNVQLSEGPENLSNKLLFLEWHSYPSKSLPAGLQVDELVELHMANSNLDQLWYGCKSAFNLKVINLSNSLHLTKTPDFTGIPNLESLILEGCTSLSEVHPSLGYHKKLQYVNLMDCESVRILPSNLEMESLKVCILDGCSKLEKFPDIVGNMNCLMVLRLDGTGIEELSSSIHHLIGLEVLSMKTCKNLKSIPSSIGCLKSLKKLDLFGCSEFENIPENLGKVESLEEFDGLSNPRPGFGIAIPGNEIPGWFNHQSMGSSISVQVPSWSMGFVACVAFSANGESPSLFCHFKANGRENYPSPMCISCNYIQVLSDHIWLFYLSFDHLKELKEWKHESYSNIELSFHSFQPGVKVKNCGVCLLSSVYITPQPSSAHFIVTSKEAASSFRASLTFSSSDHQWKATVFPRMLSLVVTLKSNLAQRFIVPVEKEPEKVMAIRSRLFKAIEESGLSVIIFARDCASLHWCFEELVKIVGFVDEMRSDTVFPVSCDVEQSKIDDQTESYTIVFDKNEENLRENEEKVQRWRNILNEVEISSGSKSLTIPKLQQLLQQHQQLQLLEHKLMLEEQQLQQQWQQTWWRQQQLDEELLRQQQVLQPVLRQQQRRQQQLQRRQQQGLQQLQHLLQQQQLQQQLPWFWSGINLL

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
81-235 TIR
Toll/interleukin-1 receptor homology (TIR) domain

EKIRSHWNKKKEKGFGSCFRGKDTRDNFTSHLYSNLKQRGIDVYMDDRELERGKTIEPALWKAIEESRFSVIIFSKDYASSPWCLDELVKIVQCMKEMGQSVLPVFYDVDPSEVAEQKGQYEKAFVEHEQNFKENLEKVQNWKDCLSTVANLSGW

Gene3D: G3DSA:3.40.50.10140
98-223 G3DSA:3.40.50.10140

CFRGKDTRDNFTSHLYSNLKQRGIDVYMDDRELERGKTIEPALWKAIEESRFSVIIFSKDYASSPWCLDELVKIVQCMKEMGQSVLPVFYDVDPSEVAEQKGQYEKAFVEHEQNFKENLEKVQNWK

HMMPfam: PF01582
IPR000157
98-226 TIR
Toll/interleukin-1 receptor homology (TIR) domain

CFRGKDTRDNFTSHLYSNLKQRGIDVYMDDRELERGKTIEPALWKAIEESRFSVIIFSKDYASSPWCLDELVKIVQCMKEMGQSVLPVFYDVDPSEVAEQKGQYEKAFVEHEQNFKENLEKVQNWKDCL

HMMSmart: SM00255
IPR000157
98-232 TIR
Toll/interleukin-1 receptor homology (TIR) domain

CFRGKDTRDNFTSHLYSNLKQRGIDVYMDDRELERGKTIEPALWKAIEESRFSVIIFSKDYASSPWCLDELVKIVQCMKEMGQSVLPVFYDVDPSEVAEQKGQYEKAFVEHEQNFKENLEKVQNWKDCLSTVANL

ProfileScan: PS50104
IPR000157
99-232 TIR
Toll/interleukin-1 receptor homology (TIR) domain

FRGKDTRDNFTSHLYSNLKQRGIDVYMDDRELERGKTIEPALWKAIEESRFSVIIFSKDYASSPWCLDELVKIVQCMKEMGQSVLPVFYDVDPSEVAEQKGQYEKAFVEHEQNFKENLEKVQNWKDCLSTVANL

HMMPanther: PTHR11017:SF20
114-867 PTHR11017:SF20,SUBFAMILY NOT NAMED

SNLKQRGIDVYMDDRELERGKTIEPALWKAIEESRFSVIIFSKDYASSPWCLDELVKIVQCMKEMGQSVLPVFYDVDPSEVAEQKGQYEKAFVEHEQNFKENLEKVQNWKDCLSTVANLSGWDVRNRNESESIKIIVEYISYKLSVTLPTISKKLVGIDSRVEVLNGYIREEVGKAIFIGICGMGGIGKTTVARVVYDRIRWQFEGSCFLANVREVFAEKDGRRRLQEQLLSEILMERASVWDSSRGIEMIKRRLRLKKILLILDDVDDKEQLEFLAEEPGWFGPGSRIIITSRDKKVVTGNNNNRIYEAKKLNDDDALMLFSQKAFKNDHPTEDFVELSKQVVGYANGLPLALEVIGSFLYDRSIPEWRGAINRMNEIPDGRIIDVLRVSFDGLHESDKKIFLDIACFLKGFKIDRITRILQSRGFHAGIGIPVLIERSLISVSRDQVWMHNLLQIMGKEIVRCESPEEPGRRSRLWTYEDVCLALMDNTGKEKIEAIFFDMPGIKEAQWNMKAFSKMSRLRLLKIDNVQLSEGPENLSNKLLFLEWHSYPSKSLPAGLQVDELVELHMANSNLDQLWYGCKSAFNLKVINLSNSLHLTKTPDFTGIPNLESLILEGCTSLSEVHPSLGYHKKLQYVNLMDCESVRILPSNLEMESLKVCILDGCSKLEKFPDIVGNMNCLMVLRLDGTGIEELSSSIHHLIGLEVLSMKTCKNLKSIPSSIGCLKSLKKLDLFGCSEFENIPENLGKVESLE

HMMPanther: PTHR11017
114-867 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SNLKQRGIDVYMDDRELERGKTIEPALWKAIEESRFSVIIFSKDYASSPWCLDELVKIVQCMKEMGQSVLPVFYDVDPSEVAEQKGQYEKAFVEHEQNFKENLEKVQNWKDCLSTVANLSGWDVRNRNESESIKIIVEYISYKLSVTLPTISKKLVGIDSRVEVLNGYIREEVGKAIFIGICGMGGIGKTTVARVVYDRIRWQFEGSCFLANVREVFAEKDGRRRLQEQLLSEILMERASVWDSSRGIEMIKRRLRLKKILLILDDVDDKEQLEFLAEEPGWFGPGSRIIITSRDKKVVTGNNNNRIYEAKKLNDDDALMLFSQKAFKNDHPTEDFVELSKQVVGYANGLPLALEVIGSFLYDRSIPEWRGAINRMNEIPDGRIIDVLRVSFDGLHESDKKIFLDIACFLKGFKIDRITRILQSRGFHAGIGIPVLIERSLISVSRDQVWMHNLLQIMGKEIVRCESPEEPGRRSRLWTYEDVCLALMDNTGKEKIEAIFFDMPGIKEAQWNMKAFSKMSRLRLLKIDNVQLSEGPENLSNKLLFLEWHSYPSKSLPAGLQVDELVELHMANSNLDQLWYGCKSAFNLKVINLSNSLHLTKTPDFTGIPNLESLILEGCTSLSEVHPSLGYHKKLQYVNLMDCESVRILPSNLEMESLKVCILDGCSKLEKFPDIVGNMNCLMVLRLDGTGIEELSSSIHHLIGLEVLSMKTCKNLKSIPSSIGCLKSLKKLDLFGCSEFENIPENLGKVESLE

superfamily: SSF52540
251-497 SSF52540

EYISYKLSVTLPTISKKLVGIDSRVEVLNGYIREEVGKAIFIGICGMGGIGKTTVARVVYDRIRWQFEGSCFLANVREVFAEKDGRRRLQEQLLSEILMERASVWDSSRGIEMIKRRLRLKKILLILDDVDDKEQLEFLAEEPGWFGPGSRIIITSRDKKVVTGNNNNRIYEAKKLNDDDALMLFSQKAFKNDHPTEDFVELSKQVVGYANGLPLALEVIGSFLYDRSIPEWRGAINRMNEIPDGRI

Gene3D: G3DSA:3.40.50.300
265-383 G3DSA:3.40.50.300

SKKLVGIDSRVEVLNGYIREEVGKAIFIGICGMGGIGKTTVARVVYDRIRWQFEGSCFLANVREVFAEKDGRRRLQEQLLSEILMERASVWDSSRGIEMIKRRLRLKKILLILDDVDDK

HMMPfam: PF00931
IPR002182
276-530 NB-ARC,NBS
NB-ARC

EVLNGYIREEVGKAIFIGICGMGGIGKTTVARVVYDRIRWQFEGSCFLANVREVFAEKDGRRRLQEQLLSEILMERASVWDSSRGIEMIKRRLRLKKILLILDDVDDKEQLEFLAEEPGWFGPGSRIIITSRDKKVVTGNNNNRIYEAKKLNDDDALMLFSQKAFKNDHPTEDFVELSKQVVGYANGLPLALEVIGSFLYDRSIPEWRGAINRMNEIPDGRIIDVLRVSFDGLHESDKKIFLDIACFLKGFKIDR

FPrintScan: PR00364
IPR000767
291-306 DISEASERSIST
Disease resistance protein

FIGICGMGGIGKTTVA

FPrintScan: PR00364
IPR000767
367-381 DISEASERSIST
Disease resistance protein

RLRLKKILLILDDVD

FPrintScan: PR00364
IPR000767
460-474 DISEASERSIST
Disease resistance protein

ANGLPLALEVIGSFL

superfamily: SSF46785
495-601 SSF46785

GRIIDVLRVSFDGLHESDKKIFLDIACFLKGFKIDRITRILQSRGFHAGIGIPVLIERSLISVSRDQVWMHNLLQIMGKEIVRCESPEEPGRRSRLWTYEDVCLALM

superfamily: SSF52058
575-1020 SSF52058,LRR

IVRCESPEEPGRRSRLWTYEDVCLALMDNTGKEKIEAIFFDMPGIKEAQWNMKAFSKMSRLRLLKIDNVQLSEGPENLSNKLLFLEWHSYPSKSLPAGLQVDELVELHMANSNLDQLWYGCKSAFNLKVINLSNSLHLTKTPDFTGIPNLESLILEGCTSLSEVHPSLGYHKKLQYVNLMDCESVRILPSNLEMESLKVCILDGCSKLEKFPDIVGNMNCLMVLRLDGTGIEELSSSIHHLIGLEVLSMKTCKNLKSIPSSIGCLKSLKKLDLFGCSEFENIPENLGKVESLEEFDGLSNPRPGFGIAIPGNEIPGWFNHQSMGSSISVQVPSWSMGFVACVAFSANGESPSLFCHFKANGRENYPSPMCISCNYIQVLSDHIWLFYLSFDHLKELKEWKHESYSNIELSFHSFQPGVKVKNCGVCLLSSVYITPQPSSAHFIVTS

Gene3D: G3DSA:3.80.10.10
675-870 G3DSA:3.80.10.10

VDELVELHMANSNLDQLWYGCKSAFNLKVINLSNSLHLTKTPDFTGIPNLESLILEGCTSLSEVHPSLGYHKKLQYVNLMDCESVRILPSNLEMESLKVCILDGCSKLEKFPDIVGNMNCLMVLRLDGTGIEELSSSIHHLIGLEVLSMKTCKNLKSIPSSIGCLKSLKKLDLFGCSEFENIPENLGKVESLEEFD

FPrintScan: PR00364
IPR000767
837-853 DISEASERSIST
Disease resistance protein

GCLKSLKKLDLFGCSEF

HMMSmart: SM00255
IPR000157
1020-1174 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SKEAASSFRASLTFSSSDHQWKATVFPRMLSLVVTLKSNLAQRFIVPVEKEPEKVMAIRSRLFKAIEESGLSVIIFARDCASLHWCFEELVKIVGFVDEMRSDTVFPVSCDVEQSKIDDQTESYTIVFDKNEENLRENEEKVQRWRNILNEVEIS

ProfileScan: PS50104
IPR000157
1025-1174 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SSFRASLTFSSSDHQWKATVFPRMLSLVVTLKSNLAQRFIVPVEKEPEKVMAIRSRLFKAIEESGLSVIIFARDCASLHWCFEELVKIVGFVDEMRSDTVFPVSCDVEQSKIDDQTESYTIVFDKNEENLRENEEKVQRWRNILNEVEIS

Gene3D: G3DSA:3.40.50.10140
1026-1165 G3DSA:3.40.50.10140

SFRASLTFSSSDHQWKATVFPRMLSLVVTLKSNLAQRFIVPVEKEPEKVMAIRSRLFKAIEESGLSVIIFARDCASLHWCFEELVKIVGFVDEMRSDTVFPVSCDVEQSKIDDQTESYTIVFDKNEENLRENEEKVQRWR

superfamily: SSF52200
IPR000157
1075-1177 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MAIRSRLFKAIEESGLSVIIFARDCASLHWCFEELVKIVGFVDEMRSDTVFPVSCDVEQSKIDDQTESYTIVFDKNEENLRENEEKVQRWRNILNEVEISSGS

HMMPfam: PF01582
IPR000157
1076-1169 TIR
Toll/interleukin-1 receptor homology (TIR) domain

AIRSRLFKAIEESGLSVIIFARDCASLHWCFEELVKIVGFVDEMRSDTVFPVSCDVEQSKIDDQTESYTIVFDKNEENLRENEEKVQRWRNILN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox