PRGDB00047418 (TIR-NBS-LRR type disease resistance protein)

From PRG Wiki
Jump to: navigation, search
TIR-NBS-LRR type disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 105922375 (DQ513199)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, TIR, Others
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa clone 171016 TIR-NBS-LRR type disease resistance protein mRNA, partial cds.

DNA Sequence

ATGCCACCTAACTCGGCATTTGACGCAACACTGATGAATTATAGAAAAAGTGATGTGGCAGAGAGAGGCATCGATGTATACATGGATGATAGGGAGCTCGAGAGAGGAAAGACCATCGAACCTGCTCTTTGGAAGGCCATCGAAGAATCAAGGTTTTCAGTCATTATATTTTCAAGAGATTACGCTTCTTCACCATGGTGCTTGGATGAACTTGTCAAGATTGTTCAGTGCATGAAAGAGATGGGGCAAACTGTTCTGCCAGTTTTTTATGATGTGGATCCCTCAGAGGTAATCGAGCGGAAACGGAAATATGAGGAAGCCTTCGTTGAGCATGAACAAAATTTCAAGGAAAACTTGGAGCAGGTCCGGAACTGGAAAGATTGTCTCTCTACGGTGGCCAATCTATCTGGCTGGGACATACGGAATAGGAATGAATCGGAATCAATTAAAAGAATTGCTAAATACATATCGTACAAACTAAGCGTCACTCTGCCAACAATTAGCAAAAAATTAGTTGGAATAGATTCTCGTGTAGAGGTATTAAATGGTTTTATAGGTGAAGAAGTTGGCGAAGCAATCTTCATAGGGATTTGTGGAATGGGTGGCATAGGTAAGACGACTATTGCAAGGGTAGTATATGATAGCTTTCGTTGGCAATTTAAAGGCAGCTGCTTCTTAGCAAATGTCAGGGATGTTTTTGCTGAGAAAGGTGGACCACGCCGTTTACAGGAACAACTTCTTTCTGAAATCTTAATGGAACGTGCTTCTGTATGTGATTCTTATAGAGGGATTGAGATGATAAAGCGGAGGTTACGACTTAAAAAGATTCTTCTTATCCTTGATGATGTAAATGACAAAAAACAACTAGAATTTTTGGCTGCAGAGCCTGGATGGTTTGGTCCAGGGAGCAGAATTATCATAACAAGCAGAGATAAAAATGTGTTTACTGGAAATGATGATACTAAAATTTATGAGGCTGAGAAATTGAATGATGATGATGCTCTTATGTTATTCAGCCAGAAAGCTTTCAAAAATGATCAACCTGCTGAAGATTTTGTGAAACTATCTAAGCAAGTTGTGGGTTATGCTAATGGCCTTCCACTGGCTCTTGAAGTTATAGGTTCGTTTTTGTATGGAAGAAGAATCCCTGAATGGAGAGGTGCGATTAATAGAATGAATGAGATTCCTGACGATGAAATTATTAAAGTGCTTCTCGTTAGTTTTGATGGCCTCCATGAATTAGAGAAGAAAATATTTTTAGACATTGCCTGTTTTCTTAAGGGATTTAAAATTGATCGAATAACAAGGATACTTGACGGGTGGCGTGGATTCCATACAGGTATTGGAATACCAGTTCTTATTGAGAGATCTCTCATAAGTGTCTCTCGGGATCAAGTCTGGATGCATAATTTATTACAGAAAATGGGTCAGGAAATTATTCGTCGTGAATCCCCTGATGAGCCTGGAAGGCGCAGTAGATTGTGGACATACGAGGATGTCTGCCTTGCACTTATGGACAACACAGGAAAAGAAAAAATAGAAGCCATTTTCTTGGACATGCCTGGAATAAAAGAGGCACAATGGAACATGAAAGCCTTCTCTAAAATGAGCAGACTAAGATTGCTCAAAATCGACAACATGCAGCTTTCTGAAGGACCAGAAGATCTTTCCAATAATTTGCGATTTCTTGAATGGCATTCTTACCCTTCAAAATCATTGCCAGCTGGTTTACAGGTGGATGAGCTAGTTGAACTTCACATGGCTAACAGTAATCTTGAGCAATTATGGTATGGGTGTAAGAGTGCAGTTAAGTTGAAAATCATCAATCTCAACAACTCACTATACCTGTCCAAGACTCCAGATCTTACTGGAATTCCTAATCTCGAGAGTCTGATTCTTGAAGGTTGTACAAGTTTGTCTGAGGTCCATCCATCACTTGGACGTCACAAGAAGCTTCAATATGTGAATCTTGTGAATTGCCGAAGTATTAGGATTCTCCCAAGCAACCTTGAAATGGAATCGCTTAAATTTTTCACTCTTGATGGCTGCTCAAAGCTTGAGAAGTTTCCAGATATAGTAGGAAACATGAACCAATTGACGGTGCTTCATTTGGATGAGACTGGTATTACAAAACTATCTTCATCAATTCATCATTTGATTGGCTTAGAAGTATTGAGCATGAACAACTGCAGGAACCTTGAAAGCATTCCGAGTAGCATAGGTTGCTTGAAATCCCTTAAAAAACTTGATCTGTCTGACTGCTCTGAACTTCAAAATATACCACAGAATTTGGGAAAAGTTGAAAGTTTGGAGTTTGATGGTTTGTCTAATCCAAGACCTGGATTTGGTATCGCCATTCCAGGAAATGAAATTCCAGGCTGGTTTAACCATCAAAGTAAGGGATCTTCAATTAGTGTGCAAGTGCCTAGTTGGAGCATGGGGTTTGTTGCGTGTGTTGCATTCAGTGCAAATGATGAAAGTCCTTCTCTTTTTTGTCATTTCAAAGCCAATGAAAGAGAGAATTATCCTTCGCCGATGTGTATTAGTTGTAAAGGCCATCTCTTTTCAGATCATATTTGGCTATTCTATCTATCTTTTGATTACCTTAAAGAGCTTCAAGAATGGCAGCATGCATCCTTTAGCAACATTGAGTTGTCATTTCAGTCTTCCGAGCCAGGAGTAAAGGTGAAGAATTGTGGTGTCTGTTTTTTATCTTCTATGTGTATTACACCACGACCATCTTCTGCCCATTTTATTGTTACAAGCAAAGAAGCAGCTTCTTCATTTAAAGCTTCTTTATATTTTTCTTCGTCGTACCATCAATGGAAGGCCAGTGTTTTCCCTGGCATCAGAGTCGCAGATCGAGCCCTGAGAGTCATTATCCCAATTGGGAAGGAACCAGAGAAAGTAATGGCAATTAGATCAAGACTCTTTGAGGCCATTAAAGAATCAGGGCTGTCAATTATTATATTTGCAAGAGATTGTGCTTCTTTACCTTGGTGCTTTAAAGAACTTGTCAAGATTGTCGGATTCATGGATGAGATGAGATCGGACACTCTATTTCCAGTTTCTTGTGATGTTGAACAATCAAAGATAGATGATCAAACAGAGAGTTACACAATTGTCTTTGATAAGATTGGAAAAAATCTCTGGGAAAACGAGGAGAAGGTCGACTTATCAACCACTTCAACAGGTGCTCCAGCAGCGGCGGCAGCAGGTGCTCCATCAGCGGTGGCAGCATGTGCAGCATGTGCAGCAGCTGCAGAGGCGGCGGCTGCAGCAGCAGTTGCAGCAGCGGCTGCAGCATCTGCTGCAGCAGCTGCTCCAGCAGCAGCAGCTCCCCGGGTTTTGGTTAGGAATTTAACTTGCTTTAGCTTGAAGATCTTCGGCAGTTTTTGCTCCCCGGCAAGAGTTGTGACTGCTGCTTGTATGGTTGGTGATGCAATTGAGCAGGAG


Protein sequences

Name Description Sequence
TIR-NBS-LRR type disease resistance protein TIR-NBS-LRR type disease resistance protein [Populus trichocarpa].

MPPNSAFDATLMNYRKSDVAERGIDVYMDDRELERGKTIEPALWKAIEESRFSVIIFSRDYASSPWCLDELVKIVQCMKEMGQTVLPVFYDVDPSEVIERKRKYEEAFVEHEQNFKENLEQVRNWKDCLSTVANLSGWDIRNRNESESIKRIAKYISYKLSVTLPTISKKLVGIDSRVEVLNGFIGEEVGEAIFIGICGMGGIGKTTIARVVYDSFRWQFKGSCFLANVRDVFAEKGGPRRLQEQLLSEILMERASVCDSYRGIEMIKRRLRLKKILLILDDVNDKKQLEFLAAEPGWFGPGSRIIITSRDKNVFTGNDDTKIYEAEKLNDDDALMLFSQKAFKNDQPAEDFVKLSKQVVGYANGLPLALEVIGSFLYGRRIPEWRGAINRMNEIPDDEIIKVLLVSFDGLHELEKKIFLDIACFLKGFKIDRITRILDGWRGFHTGIGIPVLIERSLISVSRDQVWMHNLLQKMGQEIIRRESPDEPGRRSRLWTYEDVCLALMDNTGKEKIEAIFLDMPGIKEAQWNMKAFSKMSRLRLLKIDNMQLSEGPEDLSNNLRFLEWHSYPSKSLPAGLQVDELVELHMANSNLEQLWYGCKSAVKLKIINLNNSLYLSKTPDLTGIPNLESLILEGCTSLSEVHPSLGRHKKLQYVNLVNCRSIRILPSNLEMESLKFFTLDGCSKLEKFPDIVGNMNQLTVLHLDETGITKLSSSIHHLIGLEVLSMNNCRNLESIPSSIGCLKSLKKLDLSDCSELQNIPQNLGKVESLEFDGLSNPRPGFGIAIPGNEIPGWFNHQSKGSSISVQVPSWSMGFVACVAFSANDESPSLFCHFKANERENYPSPMCISCKGHLFSDHIWLFYLSFDYLKELQEWQHASFSNIELSFQSSEPGVKVKNCGVCFLSSMCITPRPSSAHFIVTSKEAASSFKASLYFSSSYHQWKASVFPGIRVADRALRVIIPIGKEPEKVMAIRSRLFEAIKESGLSIIIFARDCASLPWCFKELVKIVGFMDEMRSDTLFPVSCDVEQSKIDDQTESYTIVFDKIGKNLWENEEKVDLSTTSTGAPAAAAAGAPSAVAACAACAAAAEAAAAAAVAAAAAASAAAAAPAAAAPRVLVRNLTCFSLKIFGSFCSPARVVTAACMVGDAIEQE

Domains

Domain Start-End Description Sequence

HMMSmart: SM00255
IPR000157
3-135 TIR
Toll/interleukin-1 receptor homology (TIR) domain

PNSAFDATLMNYRKSDVAERGIDVYMDDRELERGKTIEPALWKAIEESRFSVIIFSRDYASSPWCLDELVKIVQCMKEMGQTVLPVFYDVDPSEVIERKRKYEEAFVEHEQNFKENLEQVRNWKDCLSTVANL

HMMPfam: PF01582
IPR000157
16-129 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KSDVAERGIDVYMDDRELERGKTIEPALWKAIEESRFSVIIFSRDYASSPWCLDELVKIVQCMKEMGQTVLPVFYDVDPSEVIERKRKYEEAFVEHEQNFKENLEQVRNWKDCL

HMMPanther: PTHR11017:SF20
20-774 PTHR11017:SF20,SUBFAMILY NOT NAMED

AERGIDVYMDDRELERGKTIEPALWKAIEESRFSVIIFSRDYASSPWCLDELVKIVQCMKEMGQTVLPVFYDVDPSEVIERKRKYEEAFVEHEQNFKENLEQVRNWKDCLSTVANLSGWDIRNRNESESIKRIAKYISYKLSVTLPTISKKLVGIDSRVEVLNGFIGEEVGEAIFIGICGMGGIGKTTIARVVYDSFRWQFKGSCFLANVRDVFAEKGGPRRLQEQLLSEILMERASVCDSYRGIEMIKRRLRLKKILLILDDVNDKKQLEFLAAEPGWFGPGSRIIITSRDKNVFTGNDDTKIYEAEKLNDDDALMLFSQKAFKNDQPAEDFVKLSKQVVGYANGLPLALEVIGSFLYGRRIPEWRGAINRMNEIPDDEIIKVLLVSFDGLHELEKKIFLDIACFLKGFKIDRITRILDGWRGFHTGIGIPVLIERSLISVSRDQVWMHNLLQKMGQEIIRRESPDEPGRRSRLWTYEDVCLALMDNTGKEKIEAIFLDMPGIKEAQWNMKAFSKMSRLRLLKIDNMQLSEGPEDLSNNLRFLEWHSYPSKSLPAGLQVDELVELHMANSNLEQLWYGCKSAVKLKIINLNNSLYLSKTPDLTGIPNLESLILEGCTSLSEVHPSLGRHKKLQYVNLVNCRSIRILPSNLEMESLKFFTLDGCSKLEKFPDIVGNMNQLTVLHLDETGITKLSSSIHHLIGLEVLSMNNCRNLESIPSSIGCLKSLKKLDLSDCSELQNIPQNLGKVESLEFDG

HMMPanther: PTHR11017
20-774 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AERGIDVYMDDRELERGKTIEPALWKAIEESRFSVIIFSRDYASSPWCLDELVKIVQCMKEMGQTVLPVFYDVDPSEVIERKRKYEEAFVEHEQNFKENLEQVRNWKDCLSTVANLSGWDIRNRNESESIKRIAKYISYKLSVTLPTISKKLVGIDSRVEVLNGFIGEEVGEAIFIGICGMGGIGKTTIARVVYDSFRWQFKGSCFLANVRDVFAEKGGPRRLQEQLLSEILMERASVCDSYRGIEMIKRRLRLKKILLILDDVNDKKQLEFLAAEPGWFGPGSRIIITSRDKNVFTGNDDTKIYEAEKLNDDDALMLFSQKAFKNDQPAEDFVKLSKQVVGYANGLPLALEVIGSFLYGRRIPEWRGAINRMNEIPDDEIIKVLLVSFDGLHELEKKIFLDIACFLKGFKIDRITRILDGWRGFHTGIGIPVLIERSLISVSRDQVWMHNLLQKMGQEIIRRESPDEPGRRSRLWTYEDVCLALMDNTGKEKIEAIFLDMPGIKEAQWNMKAFSKMSRLRLLKIDNMQLSEGPEDLSNNLRFLEWHSYPSKSLPAGLQVDELVELHMANSNLEQLWYGCKSAVKLKIINLNNSLYLSKTPDLTGIPNLESLILEGCTSLSEVHPSLGRHKKLQYVNLVNCRSIRILPSNLEMESLKFFTLDGCSKLEKFPDIVGNMNQLTVLHLDETGITKLSSSIHHLIGLEVLSMNNCRNLESIPSSIGCLKSLKKLDLSDCSELQNIPQNLGKVESLEFDG

superfamily: SSF52200
IPR000157
21-138 TIR
Toll/interleukin-1 receptor homology (TIR) domain

ERGIDVYMDDRELERGKTIEPALWKAIEESRFSVIIFSRDYASSPWCLDELVKIVQCMKEMGQTVLPVFYDVDPSEVIERKRKYEEAFVEHEQNFKENLEQVRNWKDCLSTVANLSGW

ProfileScan: PS50104
IPR000157
21-135 TIR
Toll/interleukin-1 receptor homology (TIR) domain

ERGIDVYMDDRELERGKTIEPALWKAIEESRFSVIIFSRDYASSPWCLDELVKIVQCMKEMGQTVLPVFYDVDPSEVIERKRKYEEAFVEHEQNFKENLEQVRNWKDCLSTVANL

Gene3D: G3DSA:3.40.50.10140
21-125 G3DSA:3.40.50.10140

ERGIDVYMDDRELERGKTIEPALWKAIEESRFSVIIFSRDYASSPWCLDELVKIVQCMKEMGQTVLPVFYDVDPSEVIERKRKYEEAFVEHEQNFKENLEQVRNW

superfamily: SSF52540
154-400 SSF52540

KYISYKLSVTLPTISKKLVGIDSRVEVLNGFIGEEVGEAIFIGICGMGGIGKTTIARVVYDSFRWQFKGSCFLANVRDVFAEKGGPRRLQEQLLSEILMERASVCDSYRGIEMIKRRLRLKKILLILDDVNDKKQLEFLAAEPGWFGPGSRIIITSRDKNVFTGNDDTKIYEAEKLNDDDALMLFSQKAFKNDQPAEDFVKLSKQVVGYANGLPLALEVIGSFLYGRRIPEWRGAINRMNEIPDDEI

Gene3D: G3DSA:3.40.50.300
166-284 G3DSA:3.40.50.300

TISKKLVGIDSRVEVLNGFIGEEVGEAIFIGICGMGGIGKTTIARVVYDSFRWQFKGSCFLANVRDVFAEKGGPRRLQEQLLSEILMERASVCDSYRGIEMIKRRLRLKKILLILDDVN

HMMPfam: PF00931
IPR002182
178-433 NB-ARC,NBS
NB-ARC

VEVLNGFIGEEVGEAIFIGICGMGGIGKTTIARVVYDSFRWQFKGSCFLANVRDVFAEKGGPRRLQEQLLSEILMERASVCDSYRGIEMIKRRLRLKKILLILDDVNDKKQLEFLAAEPGWFGPGSRIIITSRDKNVFTGNDDTKIYEAEKLNDDDALMLFSQKAFKNDQPAEDFVKLSKQVVGYANGLPLALEVIGSFLYGRRIPEWRGAINRMNEIPDDEIIKVLLVSFDGLHELEKKIFLDIACFLKGFKIDR

FPrintScan: PR00364
IPR000767
194-209 DISEASERSIST
Disease resistance protein

FIGICGMGGIGKTTIA

FPrintScan: PR00364
IPR000767
270-284 DISEASERSIST
Disease resistance protein

RLRLKKILLILDDVN

FPrintScan: PR00364
IPR000767
363-377 DISEASERSIST
Disease resistance protein

ANGLPLALEVIGSFL

superfamily: SSF46785
398-505 SSF46785

DEIIKVLLVSFDGLHELEKKIFLDIACFLKGFKIDRITRILDGWRGFHTGIGIPVLIERSLISVSRDQVWMHNLLQKMGQEIIRRESPDEPGRRSRLWTYEDVCLALM

superfamily: SSF52058
479-774 SSF52058,LRR

IIRRESPDEPGRRSRLWTYEDVCLALMDNTGKEKIEAIFLDMPGIKEAQWNMKAFSKMSRLRLLKIDNMQLSEGPEDLSNNLRFLEWHSYPSKSLPAGLQVDELVELHMANSNLEQLWYGCKSAVKLKIINLNNSLYLSKTPDLTGIPNLESLILEGCTSLSEVHPSLGRHKKLQYVNLVNCRSIRILPSNLEMESLKFFTLDGCSKLEKFPDIVGNMNQLTVLHLDETGITKLSSSIHHLIGLEVLSMNNCRNLESIPSSIGCLKSLKKLDLSDCSELQNIPQNLGKVESLEFDG

Gene3D: G3DSA:3.80.10.10
518-772 G3DSA:3.80.10.10

LDMPGIKEAQWNMKAFSKMSRLRLLKIDNMQLSEGPEDLSNNLRFLEWHSYPSKSLPAGLQVDELVELHMANSNLEQLWYGCKSAVKLKIINLNNSLYLSKTPDLTGIPNLESLILEGCTSLSEVHPSLGRHKKLQYVNLVNCRSIRILPSNLEMESLKFFTLDGCSKLEKFPDIVGNMNQLTVLHLDETGITKLSSSIHHLIGLEVLSMNNCRNLESIPSSIGCLKSLKKLDLSDCSELQNIPQNLGKVESLEF

HMMPfam: PF00560
IPR001611
722-743 LRR_1
Leucine-rich repeat

LEVLSMNNCRNLESIPSSIGCL

FPrintScan: PR00364
IPR000767
741-757 DISEASERSIST
Disease resistance protein

GCLKSLKKLDLSDCSEL

HMMPfam: PF00560
IPR001611
745-765 LRR_1
Leucine-rich repeat

SLKKLDLSDCSELQNIPQNLG

HMMSmart: SM00255
IPR000157
928-1067 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SFKASLYFSSSYHQWKASVFPGIRVADRALRVIIPIGKEPEKVMAIRSRLFEAIKESGLSIIIFARDCASLPWCFKELVKIVGFMDEMRSDTLFPVSCDVEQSKIDDQTESYTIVFDKIGKNLWENEEKVDLSTTSTGAP

superfamily: SSF52200
IPR000157
971-1057 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MAIRSRLFEAIKESGLSIIIFARDCASLPWCFKELVKIVGFMDEMRSDTLFPVSCDVEQSKIDDQTESYTIVFDKIGKNLWENEEKV

Gene3D: G3DSA:3.40.50.10140
971-1056 G3DSA:3.40.50.10140

MAIRSRLFEAIKESGLSIIIFARDCASLPWCFKELVKIVGFMDEMRSDTLFPVSCDVEQSKIDDQTESYTIVFDKIGKNLWENEEK

HMMPfam: PF01582
IPR000157
973-1054 TIR
Toll/interleukin-1 receptor homology (TIR) domain

IRSRLFEAIKESGLSIIIFARDCASLPWCFKELVKIVGFMDEMRSDTLFPVSCDVEQSKIDDQTESYTIVFDKIGKNLWENE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox