PRGDB00047420 (NBS type disease resistance protein)

From PRG Wiki
Jump to: navigation, search
NBS type disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 105922341 (DQ513197)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa clone 2767590 NBS type disease resistance protein mRNA, complete cds.

DNA Sequence

ATGCAGAAAGCAGCCTCATCTTCTTATTCTCCTCCCCAATGGAAGTATGATGTCTTCCTTAGTTTTAGAGGCAAAGACACACGGAATAACTTTACTAGCCATCTATATTCTAATTTGGAACAAAGAGGCATCGATGTATACATGGATGATAGCGGGCTAGAGAGAGGAAAGACCATCGAACCTGCTCTCTGGCAGGCCATCGAAGATTCAAGATTTTCAATCGTTGTGTTTTCAAGAGATTACGCGTCTTCATCATGGTGCTTAGATGAGCTTGTCAAGATTGTTCAGTGCATGAAAGAGATGGGGCACACTGTTCTACCAGTTTTTTATGATGTGGATCCATCAGAGGTAGCGGATCAGACAGGGGATTATAAGAAGGCGTTCATTGAGCATAAGGAAAAGCACTCGGGAAATCTGGACAAGTGGCCAATCTATCTGGTTGGGATGTACGGAACAGGGATATGTGGAATGGGTGGCATGGGAAAGACAACTGTTGCAAGAGTCATGTATGATAGGATTCGTTGGCAATTCCATGGCAGCTGCTTCTTAGCAAATGTGAGAGAAGTTTTTGCAGAGAAAGATGGACTGTGTCGTTTACAGGAACAACTTCTTTTGGAAATCTCAATGGAGCTTCCCACTGCACGGGATTCTTCAAGAAGGATTGATTTGATAAAGCGCAGGCTGCGGCTTAAAAAGGTTCTTCTTATTCTGGATGATGTAGATGATGAAGAACAATTACAGATGTTGGCTGCAGAGCATGGATCGTTTGGTCCAGGGAGCCGGATTATCATAACGAGCAGAAATAAACATGTGCTGGATAGCCATGGTGTTACTAGAATATACGAGGCTGAGAAATTAAATGATAAAGATGCTCTTATGTTATTTAGCTGGAAAGCTTTCAAAAGAGACCAGCCTGCCGAAGATTTATCGGAACTATCCAAGCAAGTTGTGGGTTATGCTAATGGCCTTCCACTAGCTCTTGAAGTCATAGAAAAATATTAA


Protein sequences

Name Description Sequence
NBS type disease resistance protein NBS type disease resistance protein [Populus trichocarpa].

MQKAASSSYSPPQWKYDVFLSFRGKDTRNNFTSHLYSNLEQRGIDVYMDDSGLERGKTIEPALWQAIEDSRFSIVVFSRDYASSSWCLDELVKIVQCMKEMGHTVLPVFYDVDPSEVADQTGDYKKAFIEHKEKHSGNLDKWPIYLVGMYGTGICGMGGMGKTTVARVMYDRIRWQFHGSCFLANVREVFAEKDGLCRLQEQLLLEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGSFGPGSRIIITSRNKHVLDSHGVTRIYEAEKLNDKDALMLFSWKAFKRDQPAEDLSELSKQVVGYANGLPLALEVIEKY

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
4-146 TIR
Toll/interleukin-1 receptor homology (TIR) domain

AASSSYSPPQWKYDVFLSFRGKDTRNNFTSHLYSNLEQRGIDVYMDDSGLERGKTIEPALWQAIEDSRFSIVVFSRDYASSSWCLDELVKIVQCMKEMGHTVLPVFYDVDPSEVADQTGDYKKAFIEHKEKHSGNLDKWPIYL

Gene3D: G3DSA:3.40.50.10140
13-132 G3DSA:3.40.50.10140

QWKYDVFLSFRGKDTRNNFTSHLYSNLEQRGIDVYMDDSGLERGKTIEPALWQAIEDSRFSIVVFSRDYASSSWCLDELVKIVQCMKEMGHTVLPVFYDVDPSEVADQTGDYKKAFIEHK

ProfileScan: PS50104
IPR000157
14-142 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WKYDVFLSFRGKDTRNNFTSHLYSNLEQRGIDVYMDDSGLERGKTIEPALWQAIEDSRFSIVVFSRDYASSSWCLDELVKIVQCMKEMGHTVLPVFYDVDPSEVADQTGDYKKAFIEHKEKHSGNLDKW

HMMSmart: SM00255
IPR000157
15-152 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KYDVFLSFRGKDTRNNFTSHLYSNLEQRGIDVYMDDSGLERGKTIEPALWQAIEDSRFSIVVFSRDYASSSWCLDELVKIVQCMKEMGHTVLPVFYDVDPSEVADQTGDYKKAFIEHKEKHSGNLDKWPIYLVGMYGT

HMMPfam: PF01582
IPR000157
18-137 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGKDTRNNFTSHLYSNLEQRGIDVYMDDSGLERGKTIEPALWQAIEDSRFSIVVFSRDYASSSWCLDELVKIVQCMKEMGHTVLPVFYDVDPSEVADQTGDYKKAFIEHKEKHSG

FPrintScan: PR00364
IPR000767
151-166 DISEASERSIST
Disease resistance protein

GTGICGMGGMGKTTVA

Gene3D: G3DSA:3.40.50.300
152-275 G3DSA:3.40.50.300

TGICGMGGMGKTTVARVMYDRIRWQFHGSCFLANVREVFAEKDGLCRLQEQLLLEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGSFGPGSRIIITSRNKHVLDSH

HMMPanther: PTHR11017:SF20
153-330 PTHR11017:SF20,SUBFAMILY NOT NAMED

GICGMGGMGKTTVARVMYDRIRWQFHGSCFLANVREVFAEKDGLCRLQEQLLLEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGSFGPGSRIIITSRNKHVLDSHGVTRIYEAEKLNDKDALMLFSWKAFKRDQPAEDLSELSKQVVGYANGLPLALEVI

HMMPanther: PTHR11017
153-330 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GICGMGGMGKTTVARVMYDRIRWQFHGSCFLANVREVFAEKDGLCRLQEQLLLEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGSFGPGSRIIITSRNKHVLDSHGVTRIYEAEKLNDKDALMLFSWKAFKRDQPAEDLSELSKQVVGYANGLPLALEVI

HMMPfam: PF00931
IPR002182
153-330 NB-ARC,NBS
NB-ARC

GICGMGGMGKTTVARVMYDRIRWQFHGSCFLANVREVFAEKDGLCRLQEQLLLEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGSFGPGSRIIITSRNKHVLDSHGVTRIYEAEKLNDKDALMLFSWKAFKRDQPAEDLSELSKQVVGYANGLPLALEVI

superfamily: SSF52540
153-332 SSF52540

GICGMGGMGKTTVARVMYDRIRWQFHGSCFLANVREVFAEKDGLCRLQEQLLLEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGSFGPGSRIIITSRNKHVLDSHGVTRIYEAEKLNDKDALMLFSWKAFKRDQPAEDLSELSKQVVGYANGLPLALEVIEK

FPrintScan: PR00364
IPR000767
227-241 DISEASERSIST
Disease resistance protein

RLRLKKVLLILDDVD

FPrintScan: PR00364
IPR000767
320-333 DISEASERSIST
Disease resistance protein

ANGLPLALEVIEKY






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox