PRGDB00047427 (OSJNBb0022I16.16)

From PRG Wiki
Jump to: navigation, search
OSJNBb0022I16.16
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 14530841 (AC091238)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group chromosome 10 clone OSJNBb0022I16, complete sequence.

DNA Sequence

ATGACAGCATCAGTAGTTTCCTCAGTTTTGCAGAGGCTTGGTGACCTTGTCATCCAAGAAGCTACCTTTTTAAGTGATGTTCCTCGACAAGTATCATCCATGAAAGCAGAACTGAGCCAGATGCAATGCTTCTTAAATGTTGTGGATGCCAAATGTTTGGAAGGAAACAGCATGATGAAAAATCTGGCCAGTAATATTCAAGACGTGGCATACCGGGTGGAAGAGGTTATTGACAATGCTCATTTCATTTTTAGGAGGAGAAAGACTTCTGTATCAAAATATACTCACATCTTTGGTGATTCCATTGACCTCCGTGAGGTTGGCAAAAACATACAAGTTATAAGAAAGGAAATTAGTGAGATTTTTGAGCGGTACAACAGATACAACGCAGTTAATTCTAGCACTTCAACGGAAGCACAGCCCATTTTTAGGGAGGATGAGGATTTCTATGCACAAAGGCTTGTGCCGCCGGGTTTGGATCAAGGAATGGATATAGTTGGATTCGATCATGAAATTGCACAAATTAAGAGTTACTTGCTTGACCAAAATAACATGAATCTAACTGTTATATCGATTGTTGGTCAGGCAGGGGCTGGGAAGTCCACACTTGCAAAACTAGCTTATAGTTCAGTCATAACTGAAGGTTATTTTCACAAATATGGTTGGGTATCCATTTCTCCAAAATATTCTGCCCTTGAAGTATTAAGAGATCTCGTGCGACAGATAAGGGGCACTGGGAAGATAAGCGAGCGAAAGAGCATGCATTTAAATTTCTATGGTGAGACAGAGGTTTCAAAACTTATTTTTGATTTTCTGAAGGAAGAGCGCTACCTTATTGTTTTGGATGACATCTGGACAACAGATACCTGGGACAAGATCAAATCAGTATTTCCTGACAAAGGAAATGGAAGTAGAATAATTCTGACTACCCGTGATATGGAAGTTGGACAACATCCTAAAACTAAAGTGCAAATTCATACCCCTGACCTATTAGACGAAGACAAGAGCTGGGAACTTTTCCAGAAGAAGGCATTTCCACATGATGTGCAATTCACAGAACTTGAGGTGGTGGGGAAAAAACTCTCCAAGAAATGCAATGGCTTGCCACTTGCTCTAGTGGTTTTAGGTTGCTTCCTTTCACGAAACCACAATATTCATACATGGGAGAAAATGGTTGCTAGTGTAGACTGGGAAATCATGAAAAAGGAGGGCGATGTTGGACGTATATTAGCTCTAAGTTATCACAATATGTCAAATAACCTTAAAGCTTGCTTCCTTTATACTGCATCCTTTCCCGAGGACTACCCTATCACAGTTCATGTTCTTAAAAAGATGTGGATTGCTGAGGGATTTGTCCCAAATATAAGAGGATATACACAAGAAGAAGTTGCCTACAGATATGTAGAAGAGCTGGCACAGAGATGTATGATCCAAATTGAAGAAAGAAGTAAAAACATTGGGTGGATAAAGAAAATAAAAGTTCATGATGTGTTGCGTGAGTGGGGAATTGGACAAGCCAGGAAGGAAGGTTTCTTGAAAGTTTGCTCAAGCGGCACAGATGTGGAGACTTATTATGCAGATGAACAGAGGTGTTACCGTGTAGCATTTCATGGTTACTTTGATAATGAAGTGGGAAAATCAGTTCTGAATCTCCGTTCTGTGCTGGCCTTCAACCCTGATGGCAAACGTCTGTTTTCTTTCAATGGGTTGCATTTGTTGAGGGTGCTTCATTTTTGCAGTTCCTTAAAGACATGTACCTTGCCTGAAGAAATAAACAAATTGGTACATCTGAGATACCTGGGTTTGGAAGGTAGTACTGTTTTCATGTTCCCTTCTTATATGAAAGGTCTTAGAAACTTGCAAATTCTTGAAGCAAGTACAGCTACTGTCAAGGCACTTCCAAGTTCCCTCTGGAGCATCGCAGCACTAAAGCATGTTCATGTCTACCAAGTACTGCATTGGAAAGCCCAGGAGATTAGAACGAAACGAAGCTTGCAGACTCTTTATGTATTTTCCATAATGCAGTGTGATGCTCTGACGTGGAAAAGAACAATCAGGTCTCTGCAAAAAATGAGCCAACATGTTTCCTGGTGCTTAGGGATAGCCTCTACTAAACGCGTGAAGGAAAAAGAGACCCAAGAACATGAAGAATACAATTTAGATATAAGGGTAGATGCCTTAGAATCCAAAGTTGATGGTTTAGAATTGTCTGGATGTTTTAAAGAGCGTCACGTTCTGAATGATGTGCTTCCACATCATAATCTATTCCCAAACTTTCTATTGCAGCTCAAGATATCTTGTCCCAATATACTAAATGATGATCCAATGCCAATTCTGGAGAGACTTCCACGTCTTGAAGTGCTTGAAATTGTTAACTCATCATACACAGGAAAGAGAATAACATGTTCTTCCGAGGGATTCCTTGCATTACGCAGTTTGGTACTTATGGATATTGGTTTGGAGGAGTGGAATTTGCAGCAGGGATCCATGGCGTTTCTCGCTGTTTTGACTCTCAAGTGTACCATGCTGAGGAGCATCTCAAATGTACTTCACCAGCTGGATGATTTGGTAGAGCTTCGCTTGATTTGCATGCCTCAGCTCTCTGTTGATGATCATGAGCCAGCTAGGGGGAGGGGATGCCGTGTCATGATTTCAGTTGACGAGGAACAAACTTCTGATACTTGA


Protein sequences

Name Description Sequence
Putative disease resistance protein Putative disease resistance protein [Oryza sativa (japonica cultivar-group)].

MTASVVSSVLQRLGDLVIQEATFLSDVPRQVSSMKAELSQMQCFLNVVDAKCLEGNSMMKNLASNIQDVAYRVEEVIDNAHFIFRRRKTSVSKYTHIFGDSIDLREVGKNIQVIRKEISEIFERYNRYNAVNSSTSTEAQPIFREDEDFYAQRLVPPGLDQGMDIVGFDHEIAQIKSYLLDQNNMNLTVISIVGQAGAGKSTLAKLAYSSVITEGYFHKYGWVSISPKYSALEVLRDLVRQIRGTGKISERKSMHLNFYGETEVSKLIFDFLKEERYLIVLDDIWTTDTWDKIKSVFPDKGNGSRIILTTRDMEVGQHPKTKVQIHTPDLLDEDKSWELFQKKAFPHDVQFTELEVVGKKLSKKCNGLPLALVVLGCFLSRNHNIHTWEKMVASVDWEIMKKEGDVGRILALSYHNMSNNLKACFLYTASFPEDYPITVHVLKKMWIAEGFVPNIRGYTQEEVAYRYVEELAQRCMIQIEERSKNIGWIKKIKVHDVLREWGIGQARKEGFLKVCSSGTDVETYYADEQRCYRVAFHGYFDNEVGKSVLNLRSVLAFNPDGKRLFSFNGLHLLRVLHFCSSLKTCTLPEEINKLVHLRYLGLEGSTVFMFPSYMKGLRNLQILEASTATVKALPSSLWSIAALKHVHVYQVLHWKAQEIRTKRSLQTLYVFSIMQCDALTWKRTIRSLQKMSQHVSWCLGIASTKRVKEKETQEHEEYNLDIRVDALESKVDGLELSGCFKERHVLNDVLPHHNLFPNFLLQLKISCPNILNDDPMPILERLPRLEVLEIVNSSYTGKRITCSSEGFLALRSLVLMDIGLEEWNLQQGSMAFLAVLTLKCTMLRSISNVLHQLDDLVELRLICMPQLSVDDHEPARGRGCRVMISVDEEQTSDT

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
142-402 P-loop containing nucleoside triphosphate hydrolases

IFREDEDFYAQRLVPPGLDQGMDIVGFDHEIAQIKSYLLDQNNMNLTVISIVGQAGAGKSTLAKLAYSSVITEGYFHKYGWVSISPKYSALEVLRDLVRQIRGTGKISERKSMHLNFYGETEVSKLIFDFLKEERYLIVLDDIWTTDTWDKIKSVFPDKGNGSRIILTTRDMEVGQHPKTKVQIHTPDLLDEDKSWELFQKKAFPHDVQFTELEVVGKKLSKKCNGLPLALVVLGCFLSRNHNIHTWEKMVASVDWEIMKK

Gene3D: G3DSA:3.40.50.300
167-314 no description

GFDHEIAQIKSYLLDQNNMNLTVISIVGQAGAGKSTLAKLAYSSVITEGYFHKYGWVSISPKYSALEVLRDLVRQIRGTGKISERKSMHLNFYGETEVSKLIFDFLKEERYLIVLDDIWTTDTWDKIKSVFPDKGNGSRIILTTRDME

HMMPfam: PF00931
IPR002182
169-454 NB-ARC,NBS
NB-ARC

DHEIAQIKSYLLDQNNMNLTVISIVGQAGAGKSTLAKLAYSSVITEGYFHKYGWVSISPKYSALEVLRDLVRQIRGTGKISERKSMHLNFYGETEVSKLIFDFLKEERYLIVLDDIWTTDTWDKIKSVFPDKGNGSRIILTTRDMEVGQHPKTKVQIHTPDLLDEDKSWELFQKKAFPHDVQFTELEVVGKKLSKKCNGLPLALVVLGCFLSRNHNIHTWEKMVASVDWEIMKKEGDVGRILALSYHNMSNNLKACFLYTASFPEDYPITVHVLKKMWIAEGFVPN

FPrintScan: PR00364
IPR000767
189-204 DISEASERSIST
Disease resistance protein

VISIVGQAGAGKSTLA

HMMPanther: PTHR11017
190-885 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ISIVGQAGAGKSTLAKLAYSSVITEGYFHKYGWVSISPKYSALEVLRDLVRQIRGTGKISERKSMHLNFYGETEVSKLIFDFLKEERYLIVLDDIWTTDTWDKIKSVFPDKGNGSRIILTTRDMEVGQHPKTKVQIHTPDLLDEDKSWELFQKKAFPHDVQFTELEVVGKKLSKKCNGLPLALVVLGCFLSRNHNIHTWEKMVASVDWEIMKKEGDVGRILALSYHNMSNNLKACFLYTASFPEDYPITVHVLKKMWIAEGFVPNIRGYTQEEVAYRYVEELAQRCMIQIEERSKNIGWIKKIKVHDVLREWGIGQARKEGFLKVCSSGTDVETYYADEQRCYRVAFHGYFDNEVGKSVLNLRSVLAFNPDGKRLFSFNGLHLLRVLHFCSSLKTCTLPEEINKLVHLRYLGLEGSTVFMFPSYMKGLRNLQILEASTATVKALPSSLWSIAALKHVHVYQVLHWKAQEIRTKRSLQTLYVFSIMQCDALTWKRTIRSLQKMSQHVSWCLGIASTKRVKEKETQEHEEYNLDIRVDALESKVDGLELSGCFKERHVLNDVLPHHNLFPNFLLQLKISCPNILNDDPMPILERLPRLEVLEIVNSSYTGKRITCSSEGFLALRSLVLMDIGLEEWNLQQGSMAFLAVLTLKCTMLRSISNVLHQLDDLVELRLICMPQLSVDDHEPARGRGCRVMIS

FPrintScan: PR00364
IPR000767
271-285 DISEASERSIST
Disease resistance protein

FLKEERYLIVLDDIW

Seg: seg
282-294 seg

DDIWTTDTWDKIK

FPrintScan: PR00364
IPR000767
365-379 DISEASERSIST
Disease resistance protein

CNGLPLALVVLGCFL

superfamily: SSF52058
493-865 L domain-like,LRR

KVHDVLREWGIGQARKEGFLKVCSSGTDVETYYADEQRCYRVAFHGYFDNEVGKSVLNLRSVLAFNPDGKRLFSFNGLHLLRVLHFCSSLKTCTLPEEINKLVHLRYLGLEGSTVFMFPSYMKGLRNLQILEASTATVKALPSSLWSIAALKHVHVYQVLHWKAQEIRTKRSLQTLYVFSIMQCDALTWKRTIRSLQKMSQHVSWCLGIASTKRVKEKETQEHEEYNLDIRVDALESKVDGLELSGCFKERHVLNDVLPHHNLFPNFLLQLKISCPNILNDDPMPILERLPRLEVLEIVNSSYTGKRITCSSEGFLALRSLVLMDIGLEEWNLQQGSMAFLAVLTLKCTMLRSISNVLHQLDDLVELRLICMP

Gene3D: G3DSA:3.80.10.10
769-861 no description

NILNDDPMPILERLPRLEVLEIVNSSYTGKRITCSSEGFLALRSLVLMDIGLEEWNLQQGSMAFLAVLTLKCTMLRSISNVLHQLDDLVELRL

FPrintScan: PR00364
IPR000767
780-796 DISEASERSIST
Disease resistance protein

ERLPRLEVLEIVNSSYT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox