PRGDB00047447 (Os03g28400)

From PRG Wiki
Jump to: navigation, search
Os03g28400
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 57114402 (AC084380)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa chromosome 3 BAC OSJNBa0090P23 genomic sequence, complete sequence.

DNA Sequence

GTTCATATTCCCTGAAGCCGAAGTTGCATCAGAATCTGGTGATGTCTCAAATATGGTGATTGAGAAATTAGGGGCCCGCATACAACAAGATGCCTTTCCATTCGCAAATATTTATCAGCTTTAAAGCTAATGCCAGTGTGCTTCTTCCAGCTGTTTACAAGACTACAACTGGAGTGGTTTAGAGATGATGCACCTAAATATAAAGATAAGATCTTGAAGGTGTCTTGGTTGATAGTCTATAATGAAATATTCAGGGCCCGTGAACTTAGGCTTAAGACGGCTCGAGTATTGTTATGTTTGGTGAAGCGGGCCAAAGAGGCATATGAAGCTGAGCAAGCAGGTGAAGCTGCAAGTGATAATGAAATTGGTCCTGATGGGAAGGAGATTCATCCTGGTATCACACCTGTAATCATTGATGAACTTACAGAGTGCGTGTGTGATATCATTCTTTCAGCAGGACGTAAGGAAAGACAGGTTATTAAACTTATTATTGAGAAGGCAGGTGTCATGTTCGAGTGTGATCGTTGTGTGAACCAACATAATGACCCCCTGCGCAGTGCTGCTGAGCACATTAAGAAAATATCTCGCATTGACACACAGAGTTGGGATTTAATGAAAGTTGCGGCAGCGTTCAAGGTGATATGCTGCCCTGGAGAAAAAAATGAACCTGAAGAATGGGCTGTTGCGCTGAAAGAGTTTAAAACTTTTGAGGACAAGTTGGCTCTGCAGAAACTACCTGTAGGAAATGATAATTATAGAGATATCATTGAAAAGCGCTTGTTAGGGATGATTTGAGACCTGGCAAGATGATGTCGCTCCCGTCCCCCGTCGCCGCTGCGGCCGCGCTCCTCTCCGCGCCGACGCGCCTCCACGACCACCCCTTCGCCGCCTGCGTGCTCTACCGCCTCGCCCGCGCGCGCCTCTTCCCGCTCGTGCCCCCGCTCCTCGCCACGCTGCACTCCCGCGGCGCGCCGCTCCGTCCCTCCGTGCTCGCCGCCGCCTCCCGCCCCGACGCCGCGGTCCTCGTCTTCCGCGCCGTCCCGGCCTTCTGCTCCCACTCCGCCGCCACATTCCATTCGCTCCTCAACGCCCTTGTCTCCAATGGCCGCGCGGATGCCGCCAGGGACATGCTCCAGCTCGCCCCGAAGCTCGGCGTCCGTGAGGGTGAGCTGGGCGCGGCGGAGCGGCTCATCGACGAGATGGTGCGCCGGGGCGTGGCGCCAAATGCGGCCACCTACTCCCTGCTGATGCAGGGGCTCTGCGACGCCGACCTCCACGCCGACGCCGAGAAGCTGATGTTTGACATGGAGTACCGTGGCTACCAGGCCGAGGTGGTGAACTACGGCGTGCTGACGAGCTCCCGCGCGAGGCGCGGCGACGTCAACGGCGTCAGGGAGCTCCTCTCCGCCATGCGCAAGCGGAAGCTCAAGCCCGACGACGCGAGCTACAACGTCCTGATCAAGTGCCCGTGCGACGTCGGCAGGGTCGACGAGGCGCACAGGGCGCTGCTTGACATGCAGCTCAAGGGCACCGTGCCGGGCGCCGCCAACGTACCGCGTCCTCGTCGACGGGTGCTGCAGGGCTCGCGACTTCGAGCTGGGTCTACGGGTTTTCAACGCGATGTTGGCGAGCGGACACTGTCCTCAACCTCGCACCTTGTGAGAGGGCTCGGCGAGGACGGCAAGGTGGAGGAGGCGTGCTTCGTCTTGGAGCAGATGGCGAGGAGGGAGATGAGCTTGGATGCAGATGGGTGGCAAGCTGTTGTCACCTGCGTTCGCAGCAGCCGCAGCACCCAGGCAACATGTCGGGCGTCACGGCGTCCCGTGTCATGGTGGGGTCGCCGGCGGCGGCGCTGCTCGCGTTCGCGCTGCATTGCTGCGTCAGGGAGGCGGCAAGCACTGGGTTGATGTCGGAACCCGACGAGTTGAGGCGGTCGGAGAAGGAGGCGCAGTGTAACCTGCCGATGGAGTGCGCGCCGGAGAGCACGACGAGGTCGCCGACGCCGAGCCCCTTAGCGGCGAAGAAGCTGGCGGCCGTGCCGACTGCCGAGCCCGCCCGAGACCGGACCCGGGGGAGGCACGGGCGGTGGCGAGGGCGCCGGCGGCAGTGGAGGCGAGGGTGAGCTCGACGGGCGCTCGGCGCCCGACTTCCTCCCGCCGCCGACCTCCAACCTCTCCGGCCTCACCGCCAGCTTCGCCGCCAAGGGGCTCAGCGTCTTCATCCTGGAGAGTTCACGTCGGCGTTCAAGCTGAGGTAATTCTTGGACAGAGTGATAGGGAAGTTCTTCTTGAGCTCAAGAACTTTTTACAGTTTCAGAACCCGATAAACCATGGTGGGTATAACAGTTGGCCAGAGTCAGGGACCTCACCATGCCATTGGCAAGGTGTTGGTTGTGATGCCTCTGGCAGGGTTAATTTTCTCGATCTTTCAAACTCAAATATATCTGGTCCAGCCTTCCAAAACCTGTCACGCCTCAGTGGGCTCACACACTTGGACCTCTCAGCAAACAGCATCACTGGGGAGCTGCATGATGATCTCAAGAATTGCCTGCATCTCCAGTACCTAAACTTATCTTACAATCTCATCAGTGGTATTCTCGACGTCTCCAGCCTCGCCAACCTGCAGACACTAGATGTGTCCCAAAATCGGTTCGAAGGCGGCATTAGCGCAAACTTCCCAGCAATCTGCCGCAACCTAAGTGCTATCAACTTGTCCAGCAATAACCTGACAGGAAGTATAAGTGGATTGTTCAACAACTGCTTGAAGCTCCAGGATGTTGATCTCAGCTGGAACAGCTTCACTGGCAACGTCTGGAATGGAATTGCAAGGCTTAGACAGTTCAAGGCTGGAAAGAACAACTTCGCTGGGAGCATCTCTTCAAGAATTTTTTCCACGGGGTGCAAGCTCCAGTTACTAGATCTCTCCAGTAATCATTTCTATGGCAATTTCCCGAGTTCAATCGCAAATTGCGCCGGTTTGACATACCTGTCGATATGGGACAATCACTTCAATGGATCTATACCACCAGGAATTGGCTCAATCCATGGGCTTGAGGAACTCGTTCTCACGAGCAACCACTTCGATCGTGAGATACCACTTGAGCTGATGAACTGCACCAGCTTGAAATATTTGGACATCAGTGACAACAACTTTGGAGGGGAGGTGCAACAAGTTCTTGGAAAATTGACAAGCCTGACAAATCTTGTGCTACAAGAGAATAATTACAGTGGAGGCATTGTCTCCTCTGGTATACTAGAGTTGCCAAAGTTGGCCCTCCTTGACCTCAGCTTTAACAACTTCAATGGCAAGTTGCCTACTGAGATCGCTAGTATGGGTAGCATCAAGGCCCTGATGCTCGCGGAGAATAACTTCTCTGGTACAATCCCTCCATCATATGGTCAGCTTGTGAATCTCCAAGCATTGGACTTGTCATACAATAGCCTCTCCGGTGAGATTCCACCAAGCATCGGTAATTTGACATTGCTTCTCTTGTTGATGCTTGCTGGGAATCAACTTTCAGGAGAAATCCCTAGGGAGATTGGAAACTGCACTAGCCTTCTTTGGCTCAACCTTGTCGGAAACCGGCTATCTGGACAGATCCCACCAGAGATGGCAGGAATGGGGAGGAACCCCAGCTCAACCTTTGCCAAGAATCAGAAGAACCCTTCACTGATGAAATCTGTCACCAGCAAATGCCTTGCTGTATACCGTTGGGTCCCATCAAGTTACCCAGAGTTTGACTATGTCCAATCGATGATGTTCTCACACAAGAACTGCCGCACCATATGGAACCGACTGTTGATGGGGTATGACATACTTCCAGCATCTTCTCCATTACGAACAGCATTAGGGTATGTTCAGTTGTCAGGTAATCTGCTGTCTGGGCAGATACCCTCTGCAATCGGTGCCATGAAGAACATCAGCTTGCTCCTTCTCGATGGCAACCGCCTCTCTGGGCACCTACCATCAGAGATTGGCTCTCTTCAACTGGTTTCTTTGAATGCATCGAACAATTCTATTTCGGGTGAGATTCCGTTCGAGATAGGCAATTTGGGTTCCATTGAGAGCCTCGATTTGTCATGCAATAATTTCTCTGGCTCACTACCGTCGAGCCTTGAAAAGCTCTCTAAACTGAGTCAATTCAACGTGTCATACAATCCTCTTCTCACGGGCGAGGTTCCAAGCAGTGGTCAGCTCTCCACTTTCAGTGAGCTATCTTTTCTTGGTGATCCACTACTGTCATGGCGTTCAGCTGCAGGTCATCCTCGTCCTAAAAATGGCACTGGGTTCTTCTTTAATGGCACTGAGTATCCTACAAAAGAAGATATCAGTGTATGCCCCTTTTTCATCAGATCCTTAAAACATTCTTCCATGCACTTATCATTG


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Oryza sativa (japonica cultivar-group)].

MPLFHQILKTFFHALIIAEVILGQSDREVLLELKNFLQFQNPINHGGYNSWPESGTSPCHWQGVGCDASGRVNFLDLSNSNISGPAFQNLSRLSGLTHLDLSANSITGELHDDLKNCLHLQYLNLSYNLISGILDVSSLANLQTLDVSQNRFEGGISANFPAICRNLSAINLSSNNLTGSISGLFNNCLKLQDVDLSWNSFTGNVWNGIARLRQFKAGKNNFAGSISSRIFSTGCKLQLLDLSSNHFYGNFPSSIANCAGLTYLSIWDNHFNGSIPPGIGSIHGLEELVLTSNHFDREIPLELMNCTSLKYLDISDNNFGGEVQQVLGKLTSLTNLVLQENNYSGGIVSSGILELPKLALLDLSFNNFNGKLPTEIASMGSIKALMLAENNFSGTIPPSYGQLVNLQALDLSYNSLSGEIPPSIGNLTLLLLLMLAGNQLSGEIPREIGNCTSLLWLNLVGNRLSGQIPPEMAGMGRNPSSTFAKNQKNPSLMKSVTSKCLAVYRWVPSSYPEFDYVQSMMFSHKNCRTIWNRLLMGYDILPASSPLRTALGYVQLSGNLLSGQIPSAIGAMKNISLLLLDGNRLSGHLPSEIGSLQLVSLNASNNSISGEIPFEIGNLGSIESLDLSCNNFSGSLPSSLEKLSKLSQFNVSYNPLLTGEVPSSGQLSTFSELSFLGDPLLSWRSAAGHPRPKNGTGFFFNGTEYPTKEDISVPCRLPSPPETGPGGGTGGGEGAGGSGGEGELDGRSAPDFLPPPTSNLSGLTASFAAKGLSVFILESSRRRSSMSGVTASRVMVGSPAAALLAFALHCCVREAASTGLMSEPDELRRSEKEAQCNLPMECAPESTTRSPTPSPLAAKKLASLPSPVAAAAALLSAPTRLHDHPFAACVLYRLARARLFPLVPPLLATLHSRGAPLRPSVLAAASRPDAAVLVFRAVPAFCSHSAATFHSLLNALVSNGRADAARDMLQLAPKLGVREGELGAAERLIDEMVRRGVAPNAATYSLLMQGLCDADLHADAEKLMFDMEYRGYQAEVVNYGVLTSSRARRGDVNGVRELLSAMRKRKLKPDDASYNVLIKCPCDVGRVDEAHRALLDMQLKGTVPGAANVPRPRRRVLQGSRLRAGSTGFQRDVGERTLSSTSHLVRGLGEDGKVEEACFVLEQMARREMSLDADGWQAVVTCVRSSRSTQAIRDDLRPGKMMAVALKEFKTFEDKLALQKLPVGNDNYRDIIEKRLVIKLIIEKAGVMFECDRCVNQHNDPLRSAAEHIKKISRIDTQSWDLMKVAAAFKVICCPGEKNEPEEWLMPVCFFQLFTRLQLEWFRDDAPKYKDKILKVSWLIVYNEIFRARELRLKTARVLLCLVKRAKEAYEAEQAGEAASDNEIGPDGKEIHPGITPVIIDELTECVCDIILSAGRKERQRFIFPEAEVASESGDVSNMVIEKLGARIQQDAFPFANIYQL


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
21-277 SSF52058,LRR

ILGQSDREVLLELKNFLQFQNPINHGGYNSWPESGTSPCHWQGVGCDASGRVNFLDLSNSNISGPAFQNLSRLSGLTHLDLSANSITGELHDDLKNCLHLQYLNLSYNLISGILDVSSLANLQTLDVSQNRFEGGISANFPAICRNLSAINLSSNNLTGSISGLFNNCLKLQDVDLSWNSFTGNVWNGIARLRQFKAGKNNFAGSISSRIFSTGCKLQLLDLSSNHFYGNFPSSIANCAGLTYLSIWDNHFNGSIPP

HMMPanther: PTHR24420
25-693 PTHR24420,FAMILY NOT NAMED

SDREVLLELKNFLQFQNPINHGGYNSWPESGTSPCHWQGVGCDASGRVNFLDLSNSNISGPAFQNLSRLSGLTHLDLSANSITGELHDDLKNCLHLQYLNLSYNLISGILDVSSLANLQTLDVSQNRFEGGISANFPAICRNLSAINLSSNNLTGSISGLFNNCLKLQDVDLSWNSFTGNVWNGIARLRQFKAGKNNFAGSISSRIFSTGCKLQLLDLSSNHFYGNFPSSIANCAGLTYLSIWDNHFNGSIPPGIGSIHGLEELVLTSNHFDREIPLELMNCTSLKYLDISDNNFGGEVQQVLGKLTSLTNLVLQENNYSGGIVSSGILELPKLALLDLSFNNFNGKLPTEIASMGSIKALMLAENNFSGTIPPSYGQLVNLQALDLSYNSLSGEIPPSIGNLTLLLLLMLAGNQLSGEIPREIGNCTSLLWLNLVGNRLSGQIPPEMAGMGRNPSSTFAKNQKNPSLMKSVTSKCLAVYRWVPSSYPEFDYVQSMMFSHKNCRTIWNRLLMGYDILPASSPLRTALGYVQLSGNLLSGQIPSAIGAMKNISLLLLDGNRLSGHLPSEIGSLQLVSLNASNNSISGEIPFEIGNLGSIESLDLSCNNFSGSLPSSLEKLSKLSQFNVSYNPLLTGEVPSSGQLSTFSELSFLGDPLLSWRSAAGHPRPK

HMMPfam: PF08263
IPR013210
25-67 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

SDREVLLELKNFLQFQNPINHGGYNSWPESGTSPCHWQGVGCD

HMMPanther: PTHR24420:SF117
25-693 PTHR24420:SF117,SUBFAMILY NOT NAMED

SDREVLLELKNFLQFQNPINHGGYNSWPESGTSPCHWQGVGCDASGRVNFLDLSNSNISGPAFQNLSRLSGLTHLDLSANSITGELHDDLKNCLHLQYLNLSYNLISGILDVSSLANLQTLDVSQNRFEGGISANFPAICRNLSAINLSSNNLTGSISGLFNNCLKLQDVDLSWNSFTGNVWNGIARLRQFKAGKNNFAGSISSRIFSTGCKLQLLDLSSNHFYGNFPSSIANCAGLTYLSIWDNHFNGSIPPGIGSIHGLEELVLTSNHFDREIPLELMNCTSLKYLDISDNNFGGEVQQVLGKLTSLTNLVLQENNYSGGIVSSGILELPKLALLDLSFNNFNGKLPTEIASMGSIKALMLAENNFSGTIPPSYGQLVNLQALDLSYNSLSGEIPPSIGNLTLLLLLMLAGNQLSGEIPREIGNCTSLLWLNLVGNRLSGQIPPEMAGMGRNPSSTFAKNQKNPSLMKSVTSKCLAVYRWVPSSYPEFDYVQSMMFSHKNCRTIWNRLLMGYDILPASSPLRTALGYVQLSGNLLSGQIPSAIGAMKNISLLLLDGNRLSGHLPSEIGSLQLVSLNASNNSISGEIPFEIGNLGSIESLDLSCNNFSGSLPSSLEKLSKLSQFNVSYNPLLTGEVPSSGQLSTFSELSFLGDPLLSWRSAAGHPRPK

Gene3D: G3DSA:3.80.10.10
26-210 G3DSA:3.80.10.10

DREVLLELKNFLQFQNPINHGGYNSWPESGTSPCHWQGVGCDASGRVNFLDLSNSNISGPAFQNLSRLSGLTHLDLSANSITGELHDDLKNCLHLQYLNLSYNLISGILDVSSLANLQTLDVSQNRFEGGISANFPAICRNLSAINLSSNNLTGSISGLFNNCLKLQDVDLSWNSFTGNVWNGIA

ProfileScan: PS51450
IPR001611
95-117 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLTHLDLSANSITGELHDDLKNC

FPrintScan: PR00019
96-109 LEURICHRPT,Leucine-rich repeat signature

LTHLDLSANSITGE

HMMPfam: PF00560
IPR001611
96-117 LRR_1
Leucine-rich repeat

LTHLDLSANSITGELHDDLKNC

ProfileScan: PS51450
IPR001611
119-140 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLQYLNLSYNLISGILDVSSLA

HMMPfam: PF13855
141-200 LRR_8,Leucine rich repeat

NLQTLDVSQNRFEGGISANFPAICRNLSAINLSSNNLTGSISGLFNNCLKLQDVDLSWNS

ProfileScan: PS51450
IPR001611
141-153 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQTLDVSQNRFE

ProfileScan: PS51450
IPR001611
166-188 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSAINLSSNNLTGSISGLFNNC

Gene3D: G3DSA:3.80.10.10
211-346 G3DSA:3.80.10.10

RLRQFKAGKNNFAGSISSRIFSTGCKLQLLDLSSNHFYGNFPSSIANCAGLTYLSIWDNHFNGSIPPGIGSIHGLEELVLTSNHFDREIPLELMNCTSLKYLDISDNNFGGEVQQVLGKLTSLTNLVLQENNYSGG

superfamily: SSF52058
220-488 SSF52058,LRR

NNFAGSISSRIFSTGCKLQLLDLSSNHFYGNFPSSIANCAGLTYLSIWDNHFNGSIPPGIGSIHGLEELVLTSNHFDREIPLELMNCTSLKYLDISDNNFGGEVQQVLGKLTSLTNLVLQENNYSGGIVSSGILELPKLALLDLSFNNFNGKLPTEIASMGSIKALMLAENNFSGTIPPSYGQLVNLQALDLSYNSLSGEIPPSIGNLTLLLLLMLAGNQLSGEIPREIGNCTSLLWLNLVGNRLSGQIPPEMAGMGRNPSSTFAKNQK

ProfileScan: PS51450
IPR001611
236-258 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLQLLDLSSNHFYGNFPSSIANC

ProfileScan: PS51450
IPR001611
284-305 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLEELVLTSNHFDREIPLELMN

HMMPfam: PF13516
306-322 LRR_6,Leucine Rich repeat

CTSLKYLDISDNNFGGE

ProfileScan: PS51450
IPR001611
308-330 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKYLDISDNNFGGEVQQVLGKL

Gene3D: G3DSA:3.80.10.10
352-478 G3DSA:3.80.10.10

ILELPKLALLDLSFNNFNGKLPTEIASMGSIKALMLAENNFSGTIPPSYGQLVNLQALDLSYNSLSGEIPPSIGNLTLLLLLMLAGNQLSGEIPREIGNCTSLLWLNLVGNRLSGQIPPEMAGMGRN

ProfileScan: PS51450
IPR001611
357-379 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLALLDLSFNNFNGKLPTEIASM

FPrintScan: PR00019
403-416 LEURICHRPT,Leucine-rich repeat signature

LVNLQALDLSYNSL

ProfileScan: PS51450
IPR001611
405-427 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQALDLSYNSLSGEIPPSIGNL

HMMPfam: PF00560
IPR001611
405-427 LRR_1
Leucine-rich repeat

NLQALDLSYNSLSGEIPPSIGNL

ProfileScan: PS51450
IPR001611
453-475 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLLWLNLVGNRLSGQIPPEMAGM

superfamily: SSF52058
500-675 SSF52058,LRR

CLAVYRWVPSSYPEFDYVQSMMFSHKNCRTIWNRLLMGYDILPASSPLRTALGYVQLSGNLLSGQIPSAIGAMKNISLLLLDGNRLSGHLPSEIGSLQLVSLNASNNSISGEIPFEIGNLGSIESLDLSCNNFSGSLPSSLEKLSKLSQFNVSYNPLLTGEVPSSGQLSTFSELSF

Gene3D: G3DSA:3.80.10.10
551-681 G3DSA:3.80.10.10

LGYVQLSGNLLSGQIPSAIGAMKNISLLLLDGNRLSGHLPSEIGSLQLVSLNASNNSISGEIPFEIGNLGSIESLDLSCNNFSGSLPSSLEKLSKLSQFNVSYNPLLTGEVPSSGQLSTFSELSFLGDPLL

ProfileScan: PS51450
IPR001611
574-596 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NISLLLLDGNRLSGHLPSEIGSL

ProfileScan: PS51450
IPR001611
597-619 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLVSLNASNNSISGEIPFEIGNL

HMMPfam: PF00560
IPR001611
621-643 LRR_1
Leucine-rich repeat

SIESLDLSCNNFSGSLPSSLEKL

ProfileScan: PS51450
IPR001611
621-644 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SIESLDLSCNNFSGSLPSSLEKLS

ProfileScan: PS51375
IPR002885
945-979 PPR
Pentatricopeptide repeat

SAATFHSLLNALVSNGRADAARDMLQLAPKLGVRE

HMMPfam: PF01535
IPR002885
948-976 PPR
Pentatricopeptide repeat

TFHSLLNALVSNGRADAARDMLQLAPKLG

HMMPfam: PF13041
IPR002885
977-1013 PPR_2
Pentatricopeptide repeat

VREGELGAAERLIDEMVRRGVAPNAATYSLLMQGLCD

ProfileScan: PS51375
IPR002885
980-999 PPR
Pentatricopeptide repeat

GELGAAERLIDEMVRRGVAP

ProfileScan: PS51375
IPR002885
1000-1034 PPR
Pentatricopeptide repeat

NAATYSLLMQGLCDADLHADAEKLMFDMEYRGYQA

ProfileScan: PS51375
IPR002885
1035-1069 PPR
Pentatricopeptide repeat

EVVNYGVLTSSRARRGDVNGVRELLSAMRKRKLKP

HMMPfam: PF13812
IPR002885
1047-1069 PPR_3
Pentatricopeptide repeat

ARRGDVNGVRELLSAMRKRKLKP

ProfileScan: PS51375
IPR002885
1070-1104 PPR
Pentatricopeptide repeat

DDASYNVLIKCPCDVGRVDEAHRALLDMQLKGTVP

HMMTigr: TIGR00756
IPR002885
1073-1105 PPR
Pentatricopeptide repeat

SYNVLIKCPCDVGRVDEAHRALLDMQLKGTVPG

HMMPfam: PF01535
IPR002885
1073-1101 PPR
Pentatricopeptide repeat

SYNVLIKCPCDVGRVDEAHRALLDMQLKG

ProfileScan: PS51375
IPR002885
1137-1171 PPR
Pentatricopeptide repeat

TLSSTSHLVRGLGEDGKVEEACFVLEQMARREMSL

HMMPfam: PF01535
IPR002885
1142-1167 PPR
Pentatricopeptide repeat

SHLVRGLGEDGKVEEACFVLEQMARR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox