PRGDB00047448 (P0683B02.15)

From PRG Wiki
Jump to: navigation, search
P0683B02.15
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 42761484 (AC135927)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group chromosome 5 clone P0683B02, complete sequence.

DNA Sequence

ATGGCGGAAGTGGCATTGGCTAGCTTACGATTGGCAGCATCACCGATCCTGAACAAGCTCCTCGCTGACGCTTCAACATACCTTGGAGTGGACATGGCGAGTGAGCTCCGTGAACTGGAGACCAGCATCATGCCGCAGTTCGAGCTGTTGATTGAAGAAGCTGAGAAGGGCAACCACAGGGCCAAGCTGGACAAATGGATACGGGAGCTCAAAGAAGCCTTGTACAATGCCGAGGACCTGCTGGATGAGCATGAGTACGACATCCTCAAGCGCAAGGTGAAGAACGGAGGCGAGGATCCTTCTCCAGATCTAGAGCATGCCTCCTCCATCGGTTCCATCATTAAGAAACCTATGCGCGCAGCATCAAGCAGCTTGTCCAATCTGCGACCGAAGAACATAAAGCTTGTACGCCAGCTGAAGGAGCTCAAGGCCATCCTAGCGAAAGCAAGGGACTTCCGTGAAATGCTTGGCTTACCGGCTGGTAGCAGTGTAGAGGGGGCACAAACTGGACATACAAAAACAGTGGTCGTTACTGCAGCGACATCAACCCCACCACCAAAGGTGTTTGGTCGCGACGCGGACCGCGATCGCATTGTTGATCTTCTTACCCAACACAAGACTTGTGCTGAGGCTAGCCGTTTCGTTGTCTCCATTGTTGGACCTGGAGGCATGGGGAAATCCACCTTGGCTCAGTATGTTTACAATGACAAGACGATACAAGAACATTTTGACGTCACGATGTGGGTTTGCATCTCACGCAAACTTGATGTCCATCGTCATACAAGGGAGATCATCGAGTCTGCAACAAAAGAGAAGTGTCAAAGGGTTGGTAATATGGACGTTCTCCAGTACAAACTAAAAGAAATACTGCAGAAAAAAGAGAAAGTCCTGCTTGTGTTGGACGACATTTGGTTCGATAAATCCCAGGACGTTGAGGAATGGGACCTGCTACTTGCTCCCATACTATCTTCTCAGAATGGGGCAACCAAAGTTCTGGTAACTTCTCGATCTAAGACACTTCCACCTGCTCTTTTCTCTGAAGATGTCATTGATTTGGAAAATATGAAAGATACTGAGTTCCAGGCACTCTTCAAACACCATGCTTTCTCTGGAGCCACAATTCGAGACCTCCAGATGTGTGGCTGGTTCGAAGAGCATGCAGTGAAGATTACTGAAAGGCTTGGAAGATCTCCTTTGGCAGCAAAAGTTGTAGGTTCCAACTTGAAAAGGGTGATGAATATCGATGATTGGAAAGGTGCTCTCACTATAAAGATAGACAATTTAAGTGAACCTAAGAGAGCTCTGTTGTGGAGTTATCAGAAATTAGATCCATGTCTTCAGAGATGCTTTCTGTATTGCAGTTTATTTCCAAAAGGTTACAAATACATAATTGACGAGTTGGTTCACCTTTGGGTTGCAGAGGGATTTATTGATGCACGTGATACGAATAAAAGAATGGAAGATACCGGCATGGATTACTTCAAAGAGATGGTCTCTGGATCCTTTTTCCAACCATTTTCTGAAAGATTTGATAGTACGGTGTACATTATGCATGACCTCCTTCATGATTTGGCAGAGTCACTCTCTAGAGAAGACTGCTTCAGATTAGAAGATGACAAGGTGAGAGAAATACCATGCACTGTTCGGCATTTATCTGTTCGTGTTGAGAGTATTATACAACATAAGCCAAGTGTCTGCAAGCTACAACATTTGCGAACTCTTATCTGCATTGACCCACTAGTGGATGTTGGGAGCAATATTTTCGAGCAGGTAGTATTGAATCTGAAGAAGTTACAAGTACTTTATTTGTCGTTTTACAACACTAGAAAGTTGCCAGAATCAATCGGTCAGCTAAAGCATCTTCGGTATTTGAACATCAAGAAGACATTGATTTCTGAACTACCAAAATCATTATGCGATCTTTACCATTTAGAGTTACTTTATTTGCGTCCGAAATCGAGGTTACCTGACAAACTCTGCAATTTATGTAAGTTACGACATCTTCAAATGTACTCTGATGGATTGGAGCTGTCACGGATTCCTGACATAGGCCGGCTAACTTTGCTTCAACGTATTGATAGTTTTCACGTCCTAAAACAGAAGGGACATGAGTTGCGACAGCTCAGGAACATGAACGAAATTGGTGGGTATTTATCGCTCAGAAATCTTGAGAATGTGATTGGCAAGGATGAAGCTTTAGAGTCGAAGCTGTATCAGAAAAGTCGTCTTGAAGGATTGACGCTTGAGTGGAATGATGCGAATAACATGAATCCAGAGAATTGTTTACATGTTGAGATTCTTGAAGGCCTCGTGCCACCACCACAGTTGGAGCACTTATCAATTAGAGGTTACAAATCGACTACCTATCCAAGCTGGTTACTCGAGGGTTCCCAGCTTGAGAATCTAGAATCCTTTGCTCTTTATAACTGCAGCGCTTTAGAAAGGCTACCATCCAATACCAAGCTCTTTAGGCGTTGCCGTGAATTGAGCCTTAAGAATCTCCCGAATATGAAGGAACTATCATTTCTTCCAGCAGGTCTCACAACGTTGTCAATTCGTAGGTGCCCACTGCTTCTCTTCGTTACCAATGATGAACTGGAGTATCATGATCATAGTGAGCATATCCACTAG


Protein sequences

Name Description Sequence
putative NBS-LRR type disease resistance protein putative NBS-LRR type disease resistance protein [Oryza sativa (japonica cultivar-group)].

MAEVALASLRLAASPILNKLLADASTYLGVDMASELRELETSIMPQFELLIEEAEKGNHRAKLDKWIRELKEALYNAEDLLDEHEYDILKRKVKNGGEDPSPDLEHASSIGSIIKKPMRAASSSLSNLRPKNIKLVRQLKELKAILAKARDFREMLGLPAGSSVEGAQTGHTKTVVVTAATSTPPPKVFGRDADRDRIVDLLTQHKTCAEASRFVVSIVGPGGMGKSTLAQYVYNDKTIQEHFDVTMWVCISRKLDVHRHTREIIESATKEKCQRVGNMDVLQYKLKEILQKKEKVLLVLDDIWFDKSQDVEEWDLLLAPILSSQNGATKVLVTSRSKTLPPALFSEDVIDLENMKDTEFQALFKHHAFSGATIRDLQMCGWFEEHAVKITERLGRSPLAAKVVGSNLKRVMNIDDWKGALTIKIDNLSEPKRALLWSYQKLDPCLQRCFLYCSLFPKGYKYIIDELVHLWVAEGFIDARDTNKRMEDTGMDYFKEMVSGSFFQPFSERFDSTVYIMHDLLHDLAESLSREDCFRLEDDKVREIPCTVRHLSVRVESIIQHKPSVCKLQHLRTLICIDPLVDVGSNIFEQVVLNLKKLQVLYLSFYNTRKLPESIGQLKHLRYLNIKKTLISELPKSLCDLYHLELLYLRPKSRLPDKLCNLCKLRHLQMYSDGLELSRIPDIGRLTLLQRIDSFHVLKQKGHELRQLRNMNEIGGYLSLRNLENVIGKDEALESKLYQKSRLEGLTLEWNDANNMNPENCLHVEILEGLVPPPQLEHLSIRGYKSTTYPSWLLEGSQLENLESFALYNCSALERLPSNTKLFRRCRELSLKNLPNMKELSFLPAGLTTLSIRRCPLLLFVTNDELEYHDHSEHIH

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
4-868 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VALASLRLAASPILNKLLADASTYLGVDMASELRELETSIMPQFELLIEEAEKGNHRAKLDKWIRELKEALYNAEDLLDEHEYDILKRKVKNGGEDPSPDLEHASSIGSIIKKPMRAASSSLSNLRPKNIKLVRQLKELKAILAKARDFREMLGLPAGSSVEGAQTGHTKTVVVTAATSTPPPKVFGRDADRDRIVDLLTQHKTCAEASRFVVSIVGPGGMGKSTLAQYVYNDKTIQEHFDVTMWVCISRKLDVHRHTREIIESATKEKCQRVGNMDVLQYKLKEILQKKEKVLLVLDDIWFDKSQDVEEWDLLLAPILSSQNGATKVLVTSRSKTLPPALFSEDVIDLENMKDTEFQALFKHHAFSGATIRDLQMCGWFEEHAVKITERLGRSPLAAKVVGSNLKRVMNIDDWKGALTIKIDNLSEPKRALLWSYQKLDPCLQRCFLYCSLFPKGYKYIIDELVHLWVAEGFIDARDTNKRMEDTGMDYFKEMVSGSFFQPFSERFDSTVYIMHDLLHDLAESLSREDCFRLEDDKVREIPCTVRHLSVRVESIIQHKPSVCKLQHLRTLICIDPLVDVGSNIFEQVVLNLKKLQVLYLSFYNTRKLPESIGQLKHLRYLNIKKTLISELPKSLCDLYHLELLYLRPKSRLPDKLCNLCKLRHLQMYSDGLELSRIPDIGRLTLLQRIDSFHVLKQKGHELRQLRNMNEIGGYLSLRNLENVIGKDEALESKLYQKSRLEGLTLEWNDANNMNPENCLHVEILEGLVPPPQLEHLSIRGYKSTTYPSWLLEGSQLENLESFALYNCSALERLPSNTKLFRRCRELSLKNLPNMKELSFLPAGLTTLSIRRCPLLLFVTNDELEY

HMMPanther: PTHR23155:SF130
4-868 PTHR23155:SF130,OS01G0781700 PROTEIN

VALASLRLAASPILNKLLADASTYLGVDMASELRELETSIMPQFELLIEEAEKGNHRAKLDKWIRELKEALYNAEDLLDEHEYDILKRKVKNGGEDPSPDLEHASSIGSIIKKPMRAASSSLSNLRPKNIKLVRQLKELKAILAKARDFREMLGLPAGSSVEGAQTGHTKTVVVTAATSTPPPKVFGRDADRDRIVDLLTQHKTCAEASRFVVSIVGPGGMGKSTLAQYVYNDKTIQEHFDVTMWVCISRKLDVHRHTREIIESATKEKCQRVGNMDVLQYKLKEILQKKEKVLLVLDDIWFDKSQDVEEWDLLLAPILSSQNGATKVLVTSRSKTLPPALFSEDVIDLENMKDTEFQALFKHHAFSGATIRDLQMCGWFEEHAVKITERLGRSPLAAKVVGSNLKRVMNIDDWKGALTIKIDNLSEPKRALLWSYQKLDPCLQRCFLYCSLFPKGYKYIIDELVHLWVAEGFIDARDTNKRMEDTGMDYFKEMVSGSFFQPFSERFDSTVYIMHDLLHDLAESLSREDCFRLEDDKVREIPCTVRHLSVRVESIIQHKPSVCKLQHLRTLICIDPLVDVGSNIFEQVVLNLKKLQVLYLSFYNTRKLPESIGQLKHLRYLNIKKTLISELPKSLCDLYHLELLYLRPKSRLPDKLCNLCKLRHLQMYSDGLELSRIPDIGRLTLLQRIDSFHVLKQKGHELRQLRNMNEIGGYLSLRNLENVIGKDEALESKLYQKSRLEGLTLEWNDANNMNPENCLHVEILEGLVPPPQLEHLSIRGYKSTTYPSWLLEGSQLENLESFALYNCSALERLPSNTKLFRRCRELSLKNLPNMKELSFLPAGLTTLSIRRCPLLLFVTNDELEY

superfamily: SSF52540
171-435 SSF52540

HTKTVVVTAATSTPPPKVFGRDADRDRIVDLLTQHKTCAEASRFVVSIVGPGGMGKSTLAQYVYNDKTIQEHFDVTMWVCISRKLDVHRHTREIIESATKEKCQRVGNMDVLQYKLKEILQKKEKVLLVLDDIWFDKSQDVEEWDLLLAPILSSQNGATKVLVTSRSKTLPPALFSEDVIDLENMKDTEFQALFKHHAFSGATIRDLQMCGWFEEHAVKITERLGRSPLAAKVVGSNLKRVMNIDDWKGALTIKIDNLSEPKRAL

Gene3D: G3DSA:3.40.50.300
185-344 G3DSA:3.40.50.300

PPKVFGRDADRDRIVDLLTQHKTCAEASRFVVSIVGPGGMGKSTLAQYVYNDKTIQEHFDVTMWVCISRKLDVHRHTREIIESATKEKCQRVGNMDVLQYKLKEILQKKEKVLLVLDDIWFDKSQDVEEWDLLLAPILSSQNGATKVLVTSRSKTLPPAL

HMMPfam: PF00931
IPR002182
196-481 NB-ARC,NBS
NB-ARC

DRIVDLLTQHKTCAEASRFVVSIVGPGGMGKSTLAQYVYNDKTIQEHFDVTMWVCISRKLDVHRHTREIIESATKEKCQRVGNMDVLQYKLKEILQKKEKVLLVLDDIWFDKSQDVEEWDLLLAPILSSQNGATKVLVTSRSKTLPPALFSEDVIDLENMKDTEFQALFKHHAFSGATIRDLQMCGWFEEHAVKITERLGRSPLAAKVVGSNLKRVMNIDDWKGALTIKIDNLSEPKRALLWSYQKLDPCLQRCFLYCSLFPKGYKYIIDELVHLWVAEGFIDARD

FPrintScan: PR00364
IPR000767
215-230 DISEASERSIST
Disease resistance protein

VVSIVGPGGMGKSTLA

FPrintScan: PR00364
IPR000767
290-304 DISEASERSIST
Disease resistance protein

LQKKEKVLLVLDDIW

FPrintScan: PR00364
IPR000767
394-408 DISEASERSIST
Disease resistance protein

LGRSPLAAKVVGSNL

superfamily: SSF52058
516-856 SSF52058,LRR

IMHDLLHDLAESLSREDCFRLEDDKVREIPCTVRHLSVRVESIIQHKPSVCKLQHLRTLICIDPLVDVGSNIFEQVVLNLKKLQVLYLSFYNTRKLPESIGQLKHLRYLNIKKTLISELPKSLCDLYHLELLYLRPKSRLPDKLCNLCKLRHLQMYSDGLELSRIPDIGRLTLLQRIDSFHVLKQKGHELRQLRNMNEIGGYLSLRNLENVIGKDEALESKLYQKSRLEGLTLEWNDANNMNPENCLHVEILEGLVPPPQLEHLSIRGYKSTTYPSWLLEGSQLENLESFALYNCSALERLPSNTKLFRRCRELSLKNLPNMKELSFLPAGLTTLSIRRCP

Gene3D: G3DSA:3.80.10.10
526-817 G3DSA:3.80.10.10

ESLSREDCFRLEDDKVREIPCTVRHLSVRVESIIQHKPSVCKLQHLRTLICIDPLVDVGSNIFEQVVLNLKKLQVLYLSFYNTRKLPESIGQLKHLRYLNIKKTLISELPKSLCDLYHLELLYLRPKSRLPDKLCNLCKLRHLQMYSDGLELSRIPDIGRLTLLQRIDSFHVLKQKGHELRQLRNMNEIGGYLSLRNLENVIGKDEALESKLYQKSRLEGLTLEWNDANNMNPENCLHVEILEGLVPPPQLEHLSIRGYKSTTYPSWLLEGSQLENLESFALYNCSALERLP

FPrintScan: PR00364
IPR000767
797-813 DISEASERSIST
Disease resistance protein

SQLENLESFALYNCSAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox