PRGDB00047449 (PGEC219.9)

From PRG Wiki
Jump to: navigation, search
PGEC219.9
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 23820716 (AC135288)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Solanum demissum

Comment?

Solanum demissum chromosome 5 BAC PGEC219 genomic sequence, complete sequence.

DNA Sequence

ATGGCTGCAGATTCTTGCAATGCAGTTATAAAAGGTATAGACTCTGTGAAGAGTAGACATTTAGGAAATTTGGTGAATAATGAATTGGAGGGTGCTAAGAAACAGCTAAAGTTTGTAGCTGAATTTCTCAAGCAATTGGAGAAACGTACCCCCGAGAATAGGCTTTCTGCACAAATTGAGTCCTTATTTGAAGAAGCTCACAATGACTTTTATGAGATATGGTGCCATATGAATAATGAAGGCCGGACAAAGGTCACAATCAGAATGATTTCAAAGGTGCTGAAAAAACTAAAACCGGCGTTTATTGCTAGGCGAATCAAAGATTCAAAGCCATTGAGATCAACTATCGGAATTACTGTCGAGATGATGACATTTGTAGATTCTTTGCTTGAGAGTGTTCTGGTTCTATGGAACTGTATGAAGGATTTTATCACCCCTCGCATCACTAAAGTCGAAGTGCTTGAAAAGAAGCTGATATCTCTGAGATTCCTCATTTTTACTGCATATTCTTGCGTTTATGAGGACGAGACAACAATGAGTGATCTCTTCACCCATGCTGAGGGTGTAGCTTACACTGCTGCACACTTATCTTTCTTATATTTGGACCCGGAAAGTGTGGTGCATTCTGAGTTCTCTAAGCTGTTGGAAACAGTAAGTCCTTTTGGACCTGAATTGAGACAGATTTATACGTGTGTCCTAAAATGCCGGTCAAATTTATCAGGATCAAAAACTCCAATGATAGCTCATGAAGTTGTGGAAGGTTTTCTTTGTTCTCTCCGAGAGGACCTAGAAGAACTGCTAAGTCGTGACGACAGCTTGAAAGTGGCCTTTGATGATCATATGCAATGGCTCCAACAAGGATTGGTTTACCTTGGTACTTTTCTTCTGAACTTGCCAACACCATGCACTCAGGACCAAAAGCGATTTTCTCTTCTATCACATATTGAAGATGTGGCTAGTGAGGCGGCAATTCTGGTCTACTCCTTGTATGATGAGGATGTGGACAAGACTACTCATTTCCCTTTGCAAGTGAAGTTTAATCATGTCAAGATAGAGGGTGAGATGATTAAGCTGCATGAAACAACCGCAGTGGATTCTTTGAAGGATCTGATTGATGAAGTTCAACAAGAGCTGATGTTCTTGAGAACTTTTCTCATGGATTCATTGCAGCAGTGCATAGTGCAAGCTAAGATAACTGATGTCTTGTCACTGGTTCTATATGTAACCACCGAAGCAGGATCTGTCGTTAATTCTCTTTCAAATGATTTGGAGCAAGGAGATTTGGTCAGGGAAATGGATATTGCATATTGTCAATTGATTCTTAAGTTTAAATTTGTCAATGCAGTAATCAGACAAACGTGTCCTGTCATTTTTGATTCATCGGAATCAAACCATCCTATGAGAAAGCTTCTGGACTTTCTTCCTATTAACTTTGATGTCATTGATTCATATTTCAGCATGCTAAAATCCTCAAAGACATCATCCTTTGGTAGCGCGAAGATTGATGAGGTTTTGATGGGGTTTCTTGAATATATTCTCGATCATCTCCAAGAGTTGCTGAATGATGAAGGCAGTTTGATTGTTGCTACTACAAATGAAGTGAAAAAGTTCTACCAGGGATTGTTGCTTCTAGTAGCATTTTTCATTGACACCTCGATCCAGTACACTGAATGTGAGAGACAAAATGATCTCTTGACTGAAATTGAAACAATAGTGATTGAGGCTGAATCTGCTGTCAATTCATTGTTTAAGACTACTGAAGTAGAGCATGTGCTTTTCCATTTGAAGGTTAAGCTTAATCTTATCAAGGTAGAGAGTGGTCTGATTGAGCTACGGAAACATGAAGCCACCGTGATTTCTCCTTTGAAGGATCTAATTGTCAATGTCAAGGATGAGCTGATATTCTGGAGAAGTTTTCTCATGGATTCATTGGAGCAGACCAAAGGGAAAACTAAAATTACCGTGCCTTTTTCCGTGCAAATAAAGCTTAATCATATAAAGGTAGAGAGCAGTTTGATTGAGCTACTAAAACATGGCGTCACCATGATATCTCCTTTGAAAGGTCTGATTGAAGATGTGCAGGAAGAGCTGATATTCTTGAGAACTTTTCTCATGGATTCATTGGAGCAGTGCAAAGAGCAAACTCAAATAAGTGATGTTTTGACCATGGTTCAATCTGTGACCACTGGAGCAGGATTCCTCATTAGCTCTCGTTACTTCAATTCAAATCGAGGAGACTTGGACGGAGAAATCAATCTCTTGCATTTCGCATTGCTTCTTATGTTCAAGTTCATTAAGGCAGTGATTAGACAGATGTGTCCCGTTATTTCTGCATCCACGACAGTGATTGATCATCCTTTAATAAATCTGCTGAACTTTGTTCCTATCAACTTTGAGGTTATTTATTCTTACTTTAGCATGCTCAAATCCACAAAGACAATATATTTGAGTAGCCCGAAGATGGATGACGTTTTGATGGTGTTTCTTGACTATATTCTCAACAATATCAGTGTACTACTGAAGGATGAAACCAATTTGTTTGTTACTGCTGCAAATGAGGTGAAAAAGTTTTACCAAGGGTTGTTGCTTATAGTAACATTTATTGCTGATCCCCCCAGTCAGTACATTGAATGCAAGAACAAAAATGACCTCTTGATGGAAATTGAAACTATCGCAATTGAGGCTGAATTTGCTGTCCGTTCATCTTATGAGGATCATTCAGTGCTTTTGCCGTTGCAACTGAAGCTCAATTGTGTTATGGCAGAGAGCAGTCTGACTAAGCTACTTAAACATACCGATATGGATCCTTTGAAGAATCTGATTGTCAATGTCAAGGAAGAGTTGATATTCTTGCGGACATTTTTCATGGATTCATTGGAGCAGTGCCAAGGGGAAACCAAGATAATTCTGCCATTTCCTTTGCAGGTAAAGCTTAATCATGTCAAGGTAGAGAGCAGCTTGATCGAGCTACAGATACATGAAGCCACCTTGATGGCTCCTTTGAAGGATCTGCTTGACAATGTTAAGGGAGAGCTGATATTCTTGAGAGTTTTTCTCATGGATTGGTTTGACAAGTGTAAAGAGCAAACTAAGATAACTGATGTTCTGACCCTGGTACAATCTGTAACTACCGATACAGGATCACTCATTAATTTTCTTTCTCATAATTCAAAGCAAGGAAACTTGTCGTGGGAAATTAGTCTCTTGCATTTTGGATTGTTTCTTAAGTTTAAGTTCATCAAGAGAGTAATTGGACAGATGTGTCCCATCATTTCTGCATCATCAACTCCAGATGATGCTGCGATAAATTTGCTGGAGTTTATTCCGATTAACTTTGAGGTCATTCGTTCTTATTTCAGCAAGCTGAAATTCTCTAAGACATCATTCATAGGAATCCCAAGGATGGATGAGTTTTTGATGGAGTTCCTTGAATATATTCTAGACAATCTCTGCGAGTTACTGAAGGATGAAGCTGATTTGAGATTTCATGAGGTGAAAAAGTTTTACCAAGGGTTACTGCTCATTGAAACATTTCTTGCTGATCTCCCTGTTGAATGCAAGAAACAACAGGAGCTCCTGACAGAAATTGAAAATATCGCAATTGAGGCCGAAACTGCTGTCAGTTCCTGTTGTGAGAAGACTACTGAAGCAGACCATGTGCTATTTCCTTTGCAAGTGAAGCTTAATCATATCAAGTGCCACGAGCAATCAAAGACAACTGATGTTTTGTCCCTGATACAATCTGTTACCACCGAAGCAGGATCTGTCATCAATTCTCTCTCTCGTAATTCAAAGCAAGGAGGCTCAGCTAAGGAAATAAATCTCTCACATTTCCAATTGCTTCTTAAGTTTAAGTTTATCAAGGCAGCAATTAGACAGATGTGTCCTATCGCTTCTGCATCGTCATCATCGAACCATCTCATTATGATAAATCTGCTGAACTTTTTTCCTTTTGACTTTGAGGTCATTGATTCATATTTCAGCATGCTTAAATCCTCGAAGGCATCGTCCTTAGGTAGCTCGAAGATGGATGAGATTTTCATAGGGCTTCATGAGTACATCCTTGCCAGCCTCAAAGTGTTAACAAATAATGAAACCAATGTTGTATTTACTGATAAAAGGAAAATGTTTTACCAAGGGTTGTTGCTCCTGGTAACATTTCTTGTTGATCCCCCAAATCAGTACATTGAATATATACAGCAAAATGATCTCTTGACAGAAATTGAAACTATTGCACTCGAGGCTACAGATGTTATCCGTTCATCTTACGAGGATGCTGTAAATAGAAATGAAAGTAAGAAAGTCAATCTAGAGATCAAGCTTTTGACAGTGGCTTTCAAGCTTATCAAGTCTGAGGGAAACTTGACACATCTTCTAAAGCACAAAGCCACGTTGGAAGCTCAAATTATACCTCTGATTGAAGATACTCATGAAGAGCTTGTTTTCCTCAGAGCTTTTTTAATAGATCTTCTCAGGCAACACAAAGAGCTTTACAAATTGCATGATATTCTAGTGCATGCTGAAGTGACTGCCCACAATGCAGTACTAATCAGTGGTTCTTGTTGTGAGGAAATGAGTCTTTCATTAGTTGTGTTGCTACGTGAGATCAAGTCCGTCAAGGCAGAGGTAAGAAGTGTATGCTTTGAAGATTTGGATGCATCACCTTGCAACATGACTAAGACAAATGTAGAAGGCCTTGTCAAGTTTTTACCAAACAATCTGGACAGGGTGTTCACCTGTGATGCTGGTTCGATCCCTTTTATGAAGAATCAAATACCTGTCGTCCAAGAAAATCTGGTGTGTTTGGGCTCTTTCCTTGAACATATTGTACAGCACCGCGACATGCATAGGGAACTCAAGGACCTCGTAGAACGTGTTCAAGAGGTCGTTAATAGTTCAAAGTATGTCATTTTCTTCTCTGTCAGTTGTGATAATCCTGTTTGGTATCACTTGTTATATCTTTACGATGTCAAACAAGTGCTTAAGTTTGTTGAAGAAGAGGTGAAAATGATTTGTTTTAAAGTCCCAGACTCTTCACTCTTTGGCTTCTCCAAGACCAGTGGATTAGGATTCCTCAATTGTTTTTTGGGCAAGTTGGAGGAGCTATTACATTCTAAGCTTGACTTAATTACCGAACTGAAGCATCAAATCGGATCAGTCAAGGAAGAGTTGATACATCTAAGATCTTTTCTCAGTCATTTTTCAGAGAACAATGGTGAGCATGATGATGTTTATGGTCTTGTAACAAGTGTTACTGAAATGGCATACAAAAGTGAGTATGTTATCGACTCTTGCTTGTCGATTTCCTACCCACTCTGGTACAAATTTCATTGGATTTCTGAAGTTGTCGAGAATATAAAGCTTCTTAATAAAGATGTTAGTGAGATATTTGGAAGAAAGCATATTGAAGTGACATTGCATGAAGTTGCAAAGACTTCCACTTATCTTATTGAGCCATCTTTATTAGCTAATACTCCGACAGAAAATGAAGAAATGGTGCTTTTCCAGGATGTGATGGAGAAAATAAAAAAGCAGCTACTTGGTGGATCGTCTCAGCTAGACGTTATCTCAATAGTAGGCATGCCTGGTTTGGGCAAGACTACTCTTGCCGAGCAGATTTACAATGATCAGATAGTTGCCGGTTACTTTGATGTTCATGGTAAGTGTCATGTGACTCAAGCATATTCATGGAGAGAATTGTTACTTACTCTTTTGAATGATGTTGAGCCTTCTGATCACACGAAGAAAGCAGATGATCAATTAGCTAAAGAGCTGCGTCAAGTTTTGTTGACCAAGAGATTCTTAATCCTCATTGATGATGTATGGGACACAAAAGCATGGGACTATTTACATATGTGCTTTCAAGGTATTAAAAATGGTAGTAGAATAATCCTAACTACCCGGCTCTCTGATGTGGCGCATTATGCTAAATGTGAAAGTAATCCCCATGATCTTCCTTTACTGAGAGATGATGAGAGTTGGAAGTTATTACAGAAAAAGGTTTTCCATGGAGACAACTGCCCATCTGAACTTGGAGATGTGGGATTTCGAATAGCAAAAAGTTGTGGCAGATTGCCTCTCTTCATTGTGCTAGTAGCCGGTGTTCTGAAAGAGAAAAATAACAAAGCAGATTTGTGGAAAGAAGTAGAAGAAAGTTTAGATGAACTGAACATCGGTAGCTTGGAAGAGAGCATGTCGATAATTGGATTCAGTTATGGTTTCGTACTTGAAAATAAGGAAAAAGGACTAGAAGCTGTTGCACAAGATTTCTTGAAAAACCTTATTAGTAGAAATCTAGTCATGGACATGGAGAAAAGGTTCAATGGCACGTTGAAAACGTGTCGTGTTCATAATCTATTGCACAAATTCTGCTTGGAGAAGGCCAAACAGGAGAATTTTCTGCTCTGGATCTATAGAGATGATGATGCGGATGCTCGTATCTATCCTGACAAGCCTGAAGAATATCGTTTGTCCATACATTCTTGCCGGGATGAGTTTGCTGAGTGGCATCCACATCGCTCAAGTATCCGCTCTTTACTATTCAATGCCACCAGTGATGATCAGTATACTACAATGGCGCGTGATATCTCCTTCATCCTTAACAGCTTCAAACTTGTTAAGGTATTGGATTTGGAATCAATCAACATTGGTTATACTTTTCCAAGTGAAATAGAATCTTTAATTCACATGAAGTACTTTGCTGCTCGGACTGGAGCAGATTCAATTCCTTCATCTATAGCTAAGCTTTGGAATCTTGAAACGTTTATTATAAAAGGAATGCGAGGACAGGTAACATTACCATGCTCACTTTTGAATATGACTAAGTTGAGGCATATACATGTAAATGACCGTGCTTCATTTAATCTCGACACTATGAGTGAATCCCTTGCTAATTCACAGTTAGCTAACTTGCAAACCTTTTCCACTCCATATGTCTCTTATGGCGAAGACGTGGAGATTATATTGAGAAAGATGCCAAATTTGACAAAGCTAAAATGTATAGTTGGTTGCTCAAGGAAATGGAGGAGAGAATGTGTTCTGATTCCTAGATTAGACTTTCTAAGTCGTCTCGAATCCCTTAATTTGTTTTCCAACAACTGTCCAGTTGAATGTCTACGAGGATTCAATTTCCCTTCGGAGCTAAGGGAGTTAACTTTGTCAAATTTTTGTCTACCATGGAGCGAAATCTCAATCGTTGGAACATTGTGCAACTTGGAGGTTCTAAAGTTACTAAACAAAGCATTTGAAGGAGTTCAGTGGAATGTGAATGATACAGAGTTCCCTCAACTCAGATACTTAAAATTGGACAGCCTCAACTTTGCTCAATGGTCGATTTCTGAGGATTCGTTCCCTAGTCTTGAACGTTTGGTTTTAACAAACTGTAAAAGGCTTGAGAAAATCCCTTCTCATTTAGAGGACGTTGTTTCTCTAAAAAGCATTGAGGTAAATTGGTGCAGCTGGTCTGTTGCTAATTCAGCAGAGGAAATTCAAACAACGCAACATGAAGATATGGCAAATGATGCGTTCACAGTTACTATACAACCTCCTGATTGGGATAGAAGCGGATGTTATACTTGTGTTGGCTGGCTGCCTTCTCTTCCCCTGAATGGAATCCTGAGCTCCTTGTACGGCCTGGACAATCCTCCTCTCTATGAGTTAGCTTCTGGGGATAGTTTCAATAGCCAACAAGTTCCTACGTTCCTAAGGCCTGTGCCCCATGGAAAGGGTAGAGATAGGGAGTGCCTCGCGGATTTCTACTCTTATGGCTCGCGCCAGGCAGGACTGGGATCGCTGCCAACTGGGACTGCTCTTCAGTCTTCCTGA


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Solanum demissum].

MAADSCNAVIKGIDSVKSRHLGNLVNNELEGAKKQLKFVAEFLKQLEKRTPENRLSAQIESLFEEAHNDFYEIWCHMNNEGRTKVTIRMISKVLKKLKPAFIARRIKDSKPLRSTIGITVEMMTFVDSLLESVLVLWNCMKDFITPRITKVEVLEKKLISLRFLIFTAYSCVYEDETTMSDLFTHAEGVAYTAAHLSFLYLDPESVVHSEFSKLLETVSPFGPELRQIYTCVLKCRSNLSGSKTPMIAHEVVEGFLCSLREDLEELLSRDDSLKVAFDDHMQWLQQGLVYLGTFLLNLPTPCTQDQKRFSLLSHIEDVASEAAILVYSLYDEDVDKTTHFPLQVKFNHVKIEGEMIKLHETTAVDSLKDLIDEVQQELMFLRTFLMDSLQQCIVQAKITDVLSLVLYVTTEAGSVVNSLSNDLEQGDLVREMDIAYCQLILKFKFVNAVIRQTCPVIFDSSESNHPMRKLLDFLPINFDVIDSYFSMLKSSKTSSFGSAKIDEVLMGFLEYILDHLQELLNDEGSLIVATTNEVKKFYQGLLLLVAFFIDTSIQYTECERQNDLLTEIETIVIEAESAVNSLFKTTEVEHVLFHLKVKLNLIKVESGLIELRKHEATVISPLKDLIVNVKDELIFWRSFLMDSLEQTKGKTKITVPFSVQIKLNHIKVESSLIELLKHGVTMISPLKGLIEDVQEELIFLRTFLMDSLEQCKEQTQISDVLTMVQSVTTGAGFLISSRYFNSNRGDLDGEINLLHFALLLMFKFIKAVIRQMCPVISASTTVIDHPLINLLNFVPINFEVIYSYFSMLKSTKTIYLSSPKMDDVLMVFLDYILNNISVLLKDETNLFVTAANEVKKFYQGLLLIVTFIADPPSQYIECKNKNDLLMEIETIAIEAEFAVRSSYEDHSVLLPLQLKLNCVMAESSLTKLLKHTDMDPLKNLIVNVKEELIFLRTFFMDSLEQCQGETKIILPFPLQVKLNHVKVESSLIELQIHEATLMAPLKDLLDNVKGELIFLRVFLMDWFDKCKEQTKITDVLTLVQSVTTDTGSLINFLSHNSKQGNLSWEISLLHFGLFLKFKFIKRVIGQMCPIISASSTPDDAAINLLEFIPINFEVIRSYFSKLKFSKTSFIGIPRMDEFLMEFLEYILDNLCELLKDEADLRFHEVKKFYQGLLLIETFLADLPVECKKQQELLTEIENIAIEAETAVSSCCEKTTEADHVLFPLQVKLNHIKCHEQSKTTDVLSLIQSVTTEAGSVINSLSRNSKQGGSAKEINLSHFQLLLKFKFIKAAIRQMCPIASASSSSNHLIMINLLNFFPFDFEVIDSYFSMLKSSKASSLGSSKMDEIFIGLHEYILASLKVLTNNETNVVFTDKRKMFYQGLLLLVTFLVDPPNQYIEYIQQNDLLTEIETIALEATDVIRSSYEDAVNRNESKKVNLEIKLLTVAFKLIKSEGNLTHLLKHKATLEAQIIPLIEDTHEELVFLRAFLIDLLRQHKELYKLHDILVHAEVTAHNAVLISGSCCEEMSLSLVVLLREIKSVKAEVRSVCFEDLDASPCNMTKTNVEGLVKFLPNNLDRVFTCDAGSIPFMKNQIPVVQENLVCLGSFLEHIVQHRDMHRELKDLVERVQEVVNSSKYVIFFSVSCDNPVWYHLLYLYDVKQVLKFVEEEVKMICFKVPDSSLFGFSKTSGLGFLNCFLGKLEELLHSKLDLITELKHQIGSVKEELIHLRSFLSHFSENNGEHDDVYGLVTSVTEMAYKSEYVIDSCLSISYPLWYKFHWISEVVENIKLLNKDVSEIFGRKHIEVTLHEVAKTSTYLIEPSLLANTPTENEEMVLFQDVMEKIKKQLLGGSSQLDVISIVGMPGLGKTTLAEQIYNDQIVAGYFDVHGKCHVTQAYSWRELLLTLLNDVEPSDHTKKADDQLAKELRQVLLTKRFLILIDDVWDTKAWDYLHMCFQGIKNGSRIILTTRLSDVAHYAKCESNPHDLPLLRDDESWKLLQKKVFHGDNCPSELGDVGFRIAKSCGRLPLFIVLVAGVLKEKNNKADLWKEVEESLDELNIGSLEESMSIIGFSYGFVLENKEKGLEAVAQDFLKNLISRNLVMDMEKRFNGTLKTCRVHNLLHKFCLEKAKQENFLLWIYRDDDADARIYPDKPEEYRLSIHSCRDEFAEWHPHRSSIRSLLFNATSDDQYTTMARDISFILNSFKLVKVLDLESINIGYTFPSEIESLIHMKYFAARTGADSIPSSIAKLWNLETFIIKGMRGQVTLPCSLLNMTKLRHIHVNDRASFNLDTMSESLANSQLANLQTFSTPYVSYGEDVEIILRKMPNLTKLKCIVGCSRKWRRECVLIPRLDFLSRLESLNLFSNNCPVECLRGFNFPSELRELTLSNFCLPWSEISIVGTLCNLEVLKLLNKAFEGVQWNVNDTEFPQLRYLKLDSLNFAQWSISEDSFPSLERLVLTNCKRLEKIPSHLEDVVSLKSIEVNWCSWSVANSAEEIQTTQHEDMANDAFTVTIQPPDWDRSGCYTCVGWLPSLPLNGILSSLYGLDNPPLYELASGDSFNSQQVPTFLRPVPHGKGRDRECLADFYSYGSRQAGLGSLPTGTALQSS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
12-2530 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GIDSVKSRHLGNLVNNELEGAKKQLKFVAEFLKQLEKRTPENRLSAQIESLFEEAHNDFYEIWCHMNNEGRTKVTIRMISKVLKKLKPAFIARRIKDSKPLRSTIGITVEMMTFVDSLLESVLVLWNCMKDFITPRITKVEVLEKKLISLRFLIFTAYSCVYEDETTMSDLFTHAEGVAYTAAHLSFLYLDPESVVHSEFSKLLETVSPFGPELRQIYTCVLKCRSNLSGSKTPMIAHEVVEGFLCSLREDLEELLSRDDSLKVAFDDHMQWLQQGLVYLGTFLLNLPTPCTQDQKRFSLLSHIEDVASEAAILVYSLYDEDVDKTTHFPLQVKFNHVKIEGEMIKLHETTAVDSLKDLIDEVQQELMFLRTFLMDSLQQCIVQAKITDVLSLVLYVTTEAGSVVNSLSNDLEQGDLVREMDIAYCQLILKFKFVNAVIRQTCPVIFDSSESNHPMRKLLDFLPINFDVIDSYFSMLKSSKTSSFGSAKIDEVLMGFLEYILDHLQELLNDEGSLIVATTNEVKKFYQGLLLLVAFFIDTSIQYTECERQNDLLTEIETIVIEAESAVNSLFKTTEVEHVLFHLKVKLNLIKVESGLIELRKHEATVISPLKDLIVNVKDELIFWRSFLMDSLEQTKGKTKITVPFSVQIKLNHIKVESSLIELLKHGVTMISPLKGLIEDVQEELIFLRTFLMDSLEQCKEQTQISDVLTMVQSVTTGAGFLISSRYFNSNRGDLDGEINLLHFALLLMFKFIKAVIRQMCPVISASTTVIDHPLINLLNFVPINFEVIYSYFSMLKSTKTIYLSSPKMDDVLMVFLDYILNNISVLLKDETNLFVTAANEVKKFYQGLLLIVTFIADPPSQYIECKNKNDLLMEIETIAIEAEFAVRSSYEDHSVLLPLQLKLNCVMAESSLTKLLKHTDMDPLKNLIVNVKEELIFLRTFFMDSLEQCQGETKIILPFPLQVKLNHVKVESSLIELQIHEATLMAPLKDLLDNVKGELIFLRVFLMDWFDKCKEQTKITDVLTLVQSVTTDTGSLINFLSHNSKQGNLSWEISLLHFGLFLKFKFIKRVIGQMCPIISASSTPDDAAINLLEFIPINFEVIRSYFSKLKFSKTSFIGIPRMDEFLMEFLEYILDNLCELLKDEADLRFHEVKKFYQGLLLIETFLADLPVECKKQQELLTEIENIAIEAETAVSSCCEKTTEADHVLFPLQVKLNHIKCHEQSKTTDVLSLIQSVTTEAGSVINSLSRNSKQGGSAKEINLSHFQLLLKFKFIKAAIRQMCPIASASSSSNHLIMINLLNFFPFDFEVIDSYFSMLKSSKASSLGSSKMDEIFIGLHEYILASLKVLTNNETNVVFTDKRKMFYQGLLLLVTFLVDPPNQYIEYIQQNDLLTEIETIALEATDVIRSSYEDAVNRNESKKVNLEIKLLTVAFKLIKSEGNLTHLLKHKATLEAQIIPLIEDTHEELVFLRAFLIDLLRQHKELYKLHDILVHAEVTAHNAVLISGSCCEEMSLSLVVLLREIKSVKAEVRSVCFEDLDASPCNMTKTNVEGLVKFLPNNLDRVFTCDAGSIPFMKNQIPVVQENLVCLGSFLEHIVQHRDMHRELKDLVERVQEVVNSSKYVIFFSVSCDNPVWYHLLYLYDVKQVLKFVEEEVKMICFKVPDSSLFGFSKTSGLGFLNCFLGKLEELLHSKLDLITELKHQIGSVKEELIHLRSFLSHFSENNGEHDDVYGLVTSVTEMAYKSEYVIDSCLSISYPLWYKFHWISEVVENIKLLNKDVSEIFGRKHIEVTLHEVAKTSTYLIEPSLLANTPTENEEMVLFQDVMEKIKKQLLGGSSQLDVISIVGMPGLGKTTLAEQIYNDQIVAGYFDVHGKCHVTQAYSWRELLLTLLNDVEPSDHTKKADDQLAKELRQVLLTKRFLILIDDVWDTKAWDYLHMCFQGIKNGSRIILTTRLSDVAHYAKCESNPHDLPLLRDDESWKLLQKKVFHGDNCPSELGDVGFRIAKSCGRLPLFIVLVAGVLKEKNNKADLWKEVEESLDELNIGSLEESMSIIGFSYGFVLENKEKGLEAVAQDFLKNLISRNLVMDMEKRFNGTLKTCRVHNLLHKFCLEKAKQENFLLWIYRDDDADARIYPDKPEEYRLSIHSCRDEFAEWHPHRSSIRSLLFNATSDDQYTTMARDISFILNSFKLVKVLDLESINIGYTFPSEIESLIHMKYFAARTGADSIPSSIAKLWNLETFIIKGMRGQVTLPCSLLNMTKLRHIHVNDRASFNLDTMSESLANSQLANLQTFSTPYVSYGEDVEIILRKMPNLTKLKCIVGCSRKWRRECVLIPRLDFLSRLESLNLFSNNCPVECLRGFNFPSELRELTLSNFCLPWSEISIVGTLCNLEVLKLLNKAFEGVQWNVNDTEFPQLRYLKLDSLNFAQWSISEDSFPSLERLVLTNCKRLEKIPSHLEDVVSLKSIEVNWCSWSVANSAEEIQTTQHEDMANDAFTVTIQPPDWDRSGCYTCVGWL

HMMPanther: PTHR23155:SF121
12-2530 PTHR23155:SF121,SUBFAMILY NOT NAMED

GIDSVKSRHLGNLVNNELEGAKKQLKFVAEFLKQLEKRTPENRLSAQIESLFEEAHNDFYEIWCHMNNEGRTKVTIRMISKVLKKLKPAFIARRIKDSKPLRSTIGITVEMMTFVDSLLESVLVLWNCMKDFITPRITKVEVLEKKLISLRFLIFTAYSCVYEDETTMSDLFTHAEGVAYTAAHLSFLYLDPESVVHSEFSKLLETVSPFGPELRQIYTCVLKCRSNLSGSKTPMIAHEVVEGFLCSLREDLEELLSRDDSLKVAFDDHMQWLQQGLVYLGTFLLNLPTPCTQDQKRFSLLSHIEDVASEAAILVYSLYDEDVDKTTHFPLQVKFNHVKIEGEMIKLHETTAVDSLKDLIDEVQQELMFLRTFLMDSLQQCIVQAKITDVLSLVLYVTTEAGSVVNSLSNDLEQGDLVREMDIAYCQLILKFKFVNAVIRQTCPVIFDSSESNHPMRKLLDFLPINFDVIDSYFSMLKSSKTSSFGSAKIDEVLMGFLEYILDHLQELLNDEGSLIVATTNEVKKFYQGLLLLVAFFIDTSIQYTECERQNDLLTEIETIVIEAESAVNSLFKTTEVEHVLFHLKVKLNLIKVESGLIELRKHEATVISPLKDLIVNVKDELIFWRSFLMDSLEQTKGKTKITVPFSVQIKLNHIKVESSLIELLKHGVTMISPLKGLIEDVQEELIFLRTFLMDSLEQCKEQTQISDVLTMVQSVTTGAGFLISSRYFNSNRGDLDGEINLLHFALLLMFKFIKAVIRQMCPVISASTTVIDHPLINLLNFVPINFEVIYSYFSMLKSTKTIYLSSPKMDDVLMVFLDYILNNISVLLKDETNLFVTAANEVKKFYQGLLLIVTFIADPPSQYIECKNKNDLLMEIETIAIEAEFAVRSSYEDHSVLLPLQLKLNCVMAESSLTKLLKHTDMDPLKNLIVNVKEELIFLRTFFMDSLEQCQGETKIILPFPLQVKLNHVKVESSLIELQIHEATLMAPLKDLLDNVKGELIFLRVFLMDWFDKCKEQTKITDVLTLVQSVTTDTGSLINFLSHNSKQGNLSWEISLLHFGLFLKFKFIKRVIGQMCPIISASSTPDDAAINLLEFIPINFEVIRSYFSKLKFSKTSFIGIPRMDEFLMEFLEYILDNLCELLKDEADLRFHEVKKFYQGLLLIETFLADLPVECKKQQELLTEIENIAIEAETAVSSCCEKTTEADHVLFPLQVKLNHIKCHEQSKTTDVLSLIQSVTTEAGSVINSLSRNSKQGGSAKEINLSHFQLLLKFKFIKAAIRQMCPIASASSSSNHLIMINLLNFFPFDFEVIDSYFSMLKSSKASSLGSSKMDEIFIGLHEYILASLKVLTNNETNVVFTDKRKMFYQGLLLLVTFLVDPPNQYIEYIQQNDLLTEIETIALEATDVIRSSYEDAVNRNESKKVNLEIKLLTVAFKLIKSEGNLTHLLKHKATLEAQIIPLIEDTHEELVFLRAFLIDLLRQHKELYKLHDILVHAEVTAHNAVLISGSCCEEMSLSLVVLLREIKSVKAEVRSVCFEDLDASPCNMTKTNVEGLVKFLPNNLDRVFTCDAGSIPFMKNQIPVVQENLVCLGSFLEHIVQHRDMHRELKDLVERVQEVVNSSKYVIFFSVSCDNPVWYHLLYLYDVKQVLKFVEEEVKMICFKVPDSSLFGFSKTSGLGFLNCFLGKLEELLHSKLDLITELKHQIGSVKEELIHLRSFLSHFSENNGEHDDVYGLVTSVTEMAYKSEYVIDSCLSISYPLWYKFHWISEVVENIKLLNKDVSEIFGRKHIEVTLHEVAKTSTYLIEPSLLANTPTENEEMVLFQDVMEKIKKQLLGGSSQLDVISIVGMPGLGKTTLAEQIYNDQIVAGYFDVHGKCHVTQAYSWRELLLTLLNDVEPSDHTKKADDQLAKELRQVLLTKRFLILIDDVWDTKAWDYLHMCFQGIKNGSRIILTTRLSDVAHYAKCESNPHDLPLLRDDESWKLLQKKVFHGDNCPSELGDVGFRIAKSCGRLPLFIVLVAGVLKEKNNKADLWKEVEESLDELNIGSLEESMSIIGFSYGFVLENKEKGLEAVAQDFLKNLISRNLVMDMEKRFNGTLKTCRVHNLLHKFCLEKAKQENFLLWIYRDDDADARIYPDKPEEYRLSIHSCRDEFAEWHPHRSSIRSLLFNATSDDQYTTMARDISFILNSFKLVKVLDLESINIGYTFPSEIESLIHMKYFAARTGADSIPSSIAKLWNLETFIIKGMRGQVTLPCSLLNMTKLRHIHVNDRASFNLDTMSESLANSQLANLQTFSTPYVSYGEDVEIILRKMPNLTKLKCIVGCSRKWRRECVLIPRLDFLSRLESLNLFSNNCPVECLRGFNFPSELRELTLSNFCLPWSEISIVGTLCNLEVLKLLNKAFEGVQWNVNDTEFPQLRYLKLDSLNFAQWSISEDSFPSLERLVLTNCKRLEKIPSHLEDVVSLKSIEVNWCSWSVANSAEEIQTTQHEDMANDAFTVTIQPPDWDRSGCYTCVGWL

HMMPfam: PF12061
IPR021929
124-334 DUF3542
Late blight resistance protein R1

TFVDSLLESVLVLWNCMKDFITPRITKVEVLEKKLISLRFLIFTAYSCVYEDETTMSDLFTHAEGVAYTAAHLSFLYLDPESVVHSEFSKLLETVSPFGPELRQIYTCVLKCRSNLSGSKTPMIAHEVVEGFLCSLREDLEELLSRDDSLKVAFDDHMQWLQQGLVYLGTFLLNLPTPCTQDQKRFSLLSHIEDVASEAAILVYSLYDEDV

HMMPfam: PF12061
IPR021929
1476-1668 DUF3542
Late blight resistance protein R1

THEELVFLRAFLIDLLRQHKELYKLHDILVHAEVTAHNAVLISGSCCEEMSLSLVVLLREIKSVKAEVRSVCFEDLDASPCNMTKTNVEGLVKFLPNNLDRVFTCDAGSIPFMKNQIPVVQENLVCLGSFLEHIVQHRDMHRELKDLVERVQEVVNSSKYVIFFSVSCDNPVWYHLLYLYDVKQVLKFVEEEV

HMMPfam: PF12061
IPR021929
1668-1795 DUF3542
Late blight resistance protein R1

VKMICFKVPDSSLFGFSKTSGLGFLNCFLGKLEELLHSKLDLITELKHQIGSVKEELIHLRSFLSHFSENNGEHDDVYGLVTSVTEMAYKSEYVIDSCLSISYPLWYKFHWISEVVENIKLLNKDVSE

superfamily: SSF52540
1814-2061 SSF52540

TYLIEPSLLANTPTENEEMVLFQDVMEKIKKQLLGGSSQLDVISIVGMPGLGKTTLAEQIYNDQIVAGYFDVHGKCHVTQAYSWRELLLTLLNDVEPSDHTKKADDQLAKELRQVLLTKRFLILIDDVWDTKAWDYLHMCFQGIKNGSRIILTTRLSDVAHYAKCESNPHDLPLLRDDESWKLLQKKVFHGDNCPSELGDVGFRIAKSCGRLPLFIVLVAGVLKEKNNKADLWKEVEESLDELNIGSL

HMMPfam: PF00931
IPR002182
1836-2073 NB-ARC,NBS
NB-ARC

QDVMEKIKKQLLGGSSQLDVISIVGMPGLGKTTLAEQIYNDQIVAGYFDVHGKCHVTQAYSWRELLLTLLNDVEPSDHTKKADDQLAKELRQVLLTKRFLILIDDVWDTKAWDYLHMCFQGIKNGSRIILTTRLSDVAHYAKCESNPHDLPLLRDDESWKLLQKKVFHGDNCPSELGDVGFRIAKSCGRLPLFIVLVAGVLKEKNNKADLWKEVEESLDELNIGSLEESMSIIGFSYG

Gene3D: G3DSA:3.40.50.300
1843-1970 G3DSA:3.40.50.300

KKQLLGGSSQLDVISIVGMPGLGKTTLAEQIYNDQIVAGYFDVHGKCHVTQAYSWRELLLTLLNDVEPSDHTKKADDQLAKELRQVLLTKRFLILIDDVWDTKAWDYLHMCFQGIKNGSRIILTTRLS

FPrintScan: PR00364
IPR000767
1855-1870 DISEASERSIST
Disease resistance protein

VISIVGMPGLGKTTLA

FPrintScan: PR00364
IPR000767
1928-1942 DISEASERSIST
Disease resistance protein

VLLTKRFLILIDDVW

FPrintScan: PR00364
IPR000767
2022-2036 DISEASERSIST
Disease resistance protein

CGRLPLFIVLVAGVL

superfamily: SSF52058
2115-2491 SSF52058,LRR

RVHNLLHKFCLEKAKQENFLLWIYRDDDADARIYPDKPEEYRLSIHSCRDEFAEWHPHRSSIRSLLFNATSDDQYTTMARDISFILNSFKLVKVLDLESINIGYTFPSEIESLIHMKYFAARTGADSIPSSIAKLWNLETFIIKGMRGQVTLPCSLLNMTKLRHIHVNDRASFNLDTMSESLANSQLANLQTFSTPYVSYGEDVEIILRKMPNLTKLKCIVGCSRKWRRECVLIPRLDFLSRLESLNLFSNNCPVECLRGFNFPSELRELTLSNFCLPWSEISIVGTLCNLEVLKLLNKAFEGVQWNVNDTEFPQLRYLKLDSLNFAQWSISEDSFPSLERLVLTNCKRLEKIPSHLEDVVSLKSIEVNWCSWSVAN

Gene3D: G3DSA:3.80.10.10
2162-2358 G3DSA:3.80.10.10

CRDEFAEWHPHRSSIRSLLFNATSDDQYTTMARDISFILNSFKLVKVLDLESINIGYTFPSEIESLIHMKYFAARTGADSIPSSIAKLWNLETFIIKGMRGQVTLPCSLLNMTKLRHIHVNDRASFNLDTMSESLANSQLANLQTFSTPYVSYGEDVEIILRKMPNLTKLKCIVGCSRKWRRECVLIPRLDFLSRLE

Gene3D: G3DSA:3.80.10.10
2359-2484 G3DSA:3.80.10.10

SLNLFSNNCPVECLRGFNFPSELRELTLSNFCLPWSEISIVGTLCNLEVLKLLNKAFEGVQWNVNDTEFPQLRYLKLDSLNFAQWSISEDSFPSLERLVLTNCKRLEKIPSHLEDVVSLKSIEVNW

FPrintScan: PR00364
IPR000767
2448-2464 DISEASERSIST
Disease resistance protein

DSFPSLERLVLTNCKRL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox