PRGDB00047450 (PGEC219.9)

From PRG Wiki
Jump to: navigation, search
PGEC219.9
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 23820716 (AC135288)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Solanum demissum

Comment?

Solanum demissum chromosome 5 BAC PGEC219 genomic sequence, complete sequence.

DNA Sequence

CAGAGGAAATTCAAACAACGCAACGTGAAGATATGGCAAATGATGCGTTCACAGTTACTATACAACCTCCTGATTGGGATAGAAGATCATCTCCCTGAGAGATATTGAGAAATATGCCAAATTTGACAAAGCTAAAGTGCCTGGTTGGTTTCTCAAGGAAATGGAGGGGAGAATGTGTTCTGATTCCTAGATTAGACTTTCTAAGTCGTCTCGAATCCCTTAATTTGTTTTCCAACAACTGTCCAATTGAATGTCTACGAGGATTCAACTTCCCTTCGGAGCTTAGGGAATTAACTTTGTCAAATCTCTGTCTACCTTGGAGGAAAATTTCAATTGTTGGAACATTGTGCAACTTGGAGGTTCTAAAGTTACTAAACAAAGCCTTTGAAGGAATTCAGTGGAATGTGAATGTTACAGAGTTCCCTGAACTCAAATACTTAAAATTGGACAACCTTGACTTTGCTCAATGGTCGATTTCTGAGGATTCGTTCCCTAGTCTTGAACGTTTGGTTTTAACAAACTTACTTTGCTGCTCGGACGGGAGTAGATTCAATTCCTTCATCTATAGCTAATCTTTGGAATCTTGCAACGTTCATCATAAAAGGAATGCGAGGACAGAGACAATGATGTGGATGCTCATATCTATCCTGACAAGCCTGAAGACTATCGTTTGACCATACATTTTTGCCAGGATGAGTTTGCTGAGTGGCGTCCACATCGCTCAAGTATCCACTCTTTACTATTCAATGCCACTAGTGATGATCAGTATACTACAATGGCGCATGATATCTCCTTCATCCTTAACAGCTTCAAACTTGTTAAGCATATTCATGGAGAGAATTGTTACTTACTCTTTTGAATGATGTTGAGCCTTCTGATCACACGAAGAAAGCAGATGATCAATTAGCTAAAGAGCTGCGTCAAGTTTTGTTGACCAAGAGATTCTTAATCCTCATTGATGATGTATGGGACACAAAAGCATGGGACTATTTACATATGTGCTTTCAAGGTATTAAAAATGGTAGTAGAATAATCCTAACTACCCGGCTCTCTGATGTGGCGCATTATGCTAAATGTGAAAGTAATCCCCATGATCTTCCTTTACTGAGAGATGATGAGAGTTGGAAGTTATTACAGAAAAAGGTTTCCCATGGAGACAACTGCCCATCTGAACTTGGAGATGTGGGATTTCGAATAGCAAAAAGTTGTGGCGGATTGCCTCTCTTCATTGTGCTAGTAGCCGGTGTTCTGAAAGAGAAAAATAACAAAGCAGATTTGTGGAAAGAAGTAGAAGAAAGTCTAGATGCACTGAACATCGATAGCTTGGAAGAGAGCATGTCGATAATTGGATTCAGTTACATGAATTTGCCACATCATCTGAAGCCTTGCTTTTTGTATTTTGGAGGATTTTCGAGGGGCAAGAGCATTCACGTTTCGAAATTGAATCCAATTATGGTTGGCAGAAGTTGAAAAGACTTACACTCATCTTATTGAGCCATCTTTATTAGCTAATACTCAGACAGAAAATGAAGAAATGGTGCTTTTCCAGGATGTGATGGAGAAAATGAAAAAGAAGCTGCTACTTGGTGGACGTTATCTCAATACTGATATCTCTGAGATTCCTCATGTTTGCTGCATATTCTTGCATCTATGAGCACGAGACAATAATGAGTGATCTCTTGACCCATGCTGAGGATGTAGCTTACACTGCTGCACACTTATCTTTCTTATCTTTGGACCCGGAATGTATGGTGCATTCTGAGTTTTCTAAACTGCTGGAAACATTAAATCCTGTTAGGCCTGAATTGAGACAGATGTATAGAGTGTCCCTGTCGTCCAAGAAAATCTGGTGTATTTGGGCTCTTTCCTTGAAGATATGCATGAAGAACTCAAGGACCTCGCAGAACGTGTTGATCAAGAGATCGTTAATAGTTCAAAGTATATCGTTTTCTTCTCTGTCTGAGATAATCCTGTTTGGTATCATTGGATTTCTCAAGACTCTTGCTTGTCGGTTTCCTACCCACTCTGATGGGTTCACGTGAACCCACGGCACCCCCTCTAGAAACGGCCCTGCCGGTGTTCATTGCTAGGCGAATCAAAGATTCAATGCCATTAAGATCAACTATCGGAATCACTGCCGAGATGATGACATTT


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Solanum demissum].

MGSREPTAPPLETALPVFIARRIKDSMPLRSTIGITAEMMTFLISLRFLMFAAYSCIYEHETIMSDLLTHAEDVAYTAAHLSFLSLDPECMVHSEFSKLLETLNPVRPELRQMYRVSLSSKKIWCIWALSLKICMKNSRTSQNVLIKRSLIVQSISFSSLSEIILFGIIGFLKTLACRFPTHSVEKTYTHLIEPSLLANTQTENEEMVLFQDVMEKMKKKLLLGGRYLNTYSWRELLLTLLNDVEPSDHTKKADDQLAKELRQVLLTKRFLILIDDVWDTKAWDYLHMCFQGIKNGSRIILTTRLSDVAHYAKCESNPHDLPLLRDDESWKLLQKKVSHGDNCPSELGDVGFRIAKSCGGLPLFIVLVAGVLKEKNNKADLWKEVEESLDALNIDSLEESMSIIGFSYMNLPHHLKPCFLYFGGFSRGKSIHVSKLNPIMVGRRDNDVDAHIYPDKPEDYRLTIHFCQDEFAEWRPHRSSIHSLLFNATSDDQYTTMAHDISFILNSFKLVKYFAARTGVDSIPSSIANLWNLATFIIKGMRGQEILRNMPNLTKLKCLVGFSRKWRGECVLIPRLDFLSRLESLNLFSNNCPIECLRGFNFPSELRELTLSNLCLPWRKISIVGTLCNLEVLKLLNKAFEGIQWNVNVTEFPELKYLKLDNLDFAQWSISEDSFPSLERLVLTNSEEIQTTQREDMANDAFTVTIQPPDWDRRSSP

Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
230-441 NB-ARC,NBS
NB-ARC

TYSWRELLLTLLNDVEPSDHTKKADDQLAKELRQVLLTKRFLILIDDVWDTKAWDYLHMCFQGIKNGSRIILTTRLSDVAHYAKCESNPHDLPLLRDDESWKLLQKKVSHGDNCPSELGDVGFRIAKSCGGLPLFIVLVAGVLKEKNNKADLWKEVEESLDALNIDSLEESMSIIGFSYMNLPHHLKPCFLYFGGFSRGKSIHVSKLNPIMV

superfamily: SSF52540
255-397 SSF52540

DQLAKELRQVLLTKRFLILIDDVWDTKAWDYLHMCFQGIKNGSRIILTTRLSDVAHYAKCESNPHDLPLLRDDESWKLLQKKVSHGDNCPSELGDVGFRIAKSCGGLPLFIVLVAGVLKEKNNKADLWKEVEESLDALNIDSL

HMMPanther: PTHR11017:SF20
261-421 PTHR11017:SF20,SUBFAMILY NOT NAMED

LRQVLLTKRFLILIDDVWDTKAWDYLHMCFQGIKNGSRIILTTRLSDVAHYAKCESNPHDLPLLRDDESWKLLQKKVSHGDNCPSELGDVGFRIAKSCGGLPLFIVLVAGVLKEKNNKADLWKEVEESLDALNIDSLEESMSIIGFSYMNLPHHLKPCFLY

HMMPanther: PTHR11017
261-421 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LRQVLLTKRFLILIDDVWDTKAWDYLHMCFQGIKNGSRIILTTRLSDVAHYAKCESNPHDLPLLRDDESWKLLQKKVSHGDNCPSELGDVGFRIAKSCGGLPLFIVLVAGVLKEKNNKADLWKEVEESLDALNIDSLEESMSIIGFSYMNLPHHLKPCFLY

FPrintScan: PR00364
IPR000767
264-278 DISEASERSIST
Disease resistance protein

VLLTKRFLILIDDVW

FPrintScan: PR00364
IPR000767
358-372 DISEASERSIST
Disease resistance protein

CGGLPLFIVLVAGVL

superfamily: SSF52058
454-691 SSF52058,LRR

PDKPEDYRLTIHFCQDEFAEWRPHRSSIHSLLFNATSDDQYTTMAHDISFILNSFKLVKYFAARTGVDSIPSSIANLWNLATFIIKGMRGQEILRNMPNLTKLKCLVGFSRKWRGECVLIPRLDFLSRLESLNLFSNNCPIECLRGFNFPSELRELTLSNLCLPWRKISIVGTLCNLEVLKLLNKAFEGIQWNVNVTEFPELKYLKLDNLDFAQWSISEDSFPSLERLVLTNSEEIQT

Gene3D: G3DSA:3.80.10.10
520-685 G3DSA:3.80.10.10

VDSIPSSIANLWNLATFIIKGMRGQEILRNMPNLTKLKCLVGFSRKWRGECVLIPRLDFLSRLESLNLFSNNCPIECLRGFNFPSELRELTLSNLCLPWRKISIVGTLCNLEVLKLLNKAFEGIQWNVNVTEFPELKYLKLDNLDFAQWSISEDSFPSLERLVLTN

FPrintScan: PR00364
IPR000767
673-689 DISEASERSIST
Disease resistance protein

DSFPSLERLVLTNSEEI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox